LXL04_014183 | RubberDandelionOmics

Gene overview

LXL04_014183

Reference: OH-1004 Chr: Chr03 Coordinates: 43288238-43290024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1188 bp · LXL04_014183|LXL04_014183|OH1004|cDNA

ATGAGCAGCATGCTAACGAGGGGCATGGAAGTGAAAGCCAGGGCTCCAGGCAAGATCATACTCTCCGGCGAGCACGCCGTCGTCTATGGATCCGCCGCAGTCGCTGCTGCCATCGACCTCTACACTTACGTCTCTCTTACTTTCCCTCCACCTTCCCAAAGCTCTGATACACTCGCACTTCAGCTCAGAGACGTTGGCCTGGAATTTTCATGGCCAACTAAACGAATCAGAGAAACATTACCAAAAACAATCGATAACCC...

CDS

Download CDS FASTA

1188 bp · LXL04_014183|LXL04_014183|OH1004|CDS

ATGAGCAGCATGCTAACGAGGGGCATGGAAGTGAAAGCCAGGGCTCCAGGCAAGATCATACTCTCCGGCGAGCACGCCGTCGTCTATGGATCCGCCGCAGTCGCTGCTGCCATCGACCTCTACACTTACGTCTCTCTTACTTTCCCTCCACCTTCCCAAAGCTCTGATACACTCGCACTTCAGCTCAGAGACGTTGGCCTGGAATTTTCATGGCCAACTAAACGAATCAGAGAAACATTACCAAAAACAATCGATAACCC...

Protein

Download Protein FASTA

395 aa · LXL04_014183|LXL04_014183|OH1004|PROTEIN

MSSMLTRGMEVKARAPGKIILSGEHAVVYGSAAVAAAIDLYTYVSLTFPPPSQSSDTLALQLRDVGLEFSWPTKRIRETLPKTIDNPSCSPTSCSGETMKLITTLVEEHSIPESKIEIAAGVVVFLWLYTSIQGDKPAKVVVSSELPLASGLGSSAAYCVSLSGALLASSNAVNLDFSSEDWLSLSEKEEKLANEWAFEGEKIIHGKPSGIDNTVSTMGNLIKLESGALTSIKSNMPLKMLITDTKVSRNTKALINSVAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014183`
TK1151 ID	TkA02G448690
OH-1004 ID	LXL04_014183
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014183

Location Chr03:43288238-43290024 (+)

Description Similar to At5g27450: Mevalonate kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27450`	Catalyzes the phosphorylation of mevalonate to mevalonate 5-phosphate, a key step in isoprenoid and cholesterol biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0016310 phosphorylation Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0033386 geranylgeranyl diphosphate biosynthetic process Biological Process

GO:0033489 cholesterol biosynthetic process via desmosterol Biological Process

GO:0033490 cholesterol biosynthetic process via lathosterol Biological Process

GO:0036197 zymosterol biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G27450

bta:505792

ddi:DDB_G0272018

hsa:4598

mmu:17855

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.719

Rank 1 · LXL04_014183 · OH-1004

Nucleus0.300

Rank 2 · LXL04_014183 · OH-1004

Peroxisome0.127

Rank 3 · LXL04_014183 · OH-1004

Mitochondrion0.105

Rank 4 · LXL04_014183 · OH-1004

Plastid0.042

Rank 5 · LXL04_014183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00288.33GHMP_kinases_N134-219 aa

PF08544.19GHMP_kinases_C302-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014183	`PF00288.33`	GHMP_kinases_N	134	219	3.9e-09	37.3
LXL04_014183	`PF08544.19`	GHMP_kinases_C	302	368	4.1e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46086`	Arabidopsis thaliana	Mevalonate kinase	61.757%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card