RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_014166
Reference: OH-1004 Chr: Chr03 Coordinates: 43137006-43140339 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3120 bp · LXL04_014166|LXL04_014166|OH1004|cDNA

ATGCGAATGCAACTGCTTCTCTTGTTCTTGTGGGTCGTCGCCGCCGCCGGAGCCACATCTCCGGACGAAGTCCGGGCATTGTTCGAGTTCAAGAAAGGGATCAGTGAAGATCCCCTCAGAAAAGTCTACGATTCGTGGAACATTTCCAGCTCGGATCCAGCTTCCATTTGCCCCCAATTTTATGGCATTTCCTGCGACGAAAACGGGTTTGTTTCCGCCATTGTTCTTGACCAACTTGACTTGGCCGGAGAACTCAAATT...

CDS

Download CDS FASTA

3120 bp · LXL04_014166|LXL04_014166|OH1004|CDS

ATGCGAATGCAACTGCTTCTCTTGTTCTTGTGGGTCGTCGCCGCCGCCGGAGCCACATCTCCGGACGAAGTCCGGGCATTGTTCGAGTTCAAGAAAGGGATCAGTGAAGATCCCCTCAGAAAAGTCTACGATTCGTGGAACATTTCCAGCTCGGATCCAGCTTCCATTTGCCCCCAATTTTATGGCATTTCCTGCGACGAAAACGGGTTTGTTTCCGCCATTGTTCTTGACCAACTTGACTTGGCCGGAGAACTCAAATT...

Protein

Download Protein FASTA

1039 aa · LXL04_014166|LXL04_014166|OH1004|PROTEIN

MRMQLLLLFLWVVAAAGATSPDEVRALFEFKKGISEDPLRKVYDSWNISSSDPASICPQFYGISCDENGFVSAIVLDQLDLAGELKFFTLYSLKMLRNLSLSGNRLSGRLVPSLGSMYSLQYLDLSGNQFYGPIPARINDLYGLNYLNLSNNNFTGGFPTGIRNLQQLMVLDLHSNSLWGDIGVMFSELRNVQHVDLSDNSFYGSLSNVANNSSAVNTLQHVNLSRNRLGGGFFTGDSLVLFRNLHVLDLGDNELNGKLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_014166
TK1151 IDTkA02G449290
OH-1004 IDLXL04_014166
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_014166
LocationChr03:43137006-43140339 (+)
DescriptionSimilar to At5g10020: Probable inactive receptor kinase At5g10020
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g10020 Probable inactive receptor kinase At5g10020. No verified direct reference in this release
At4g20940 Receptor kinase acting as an early component in abscisic acid (ABA) signaling.
A plasma membrane receptor kinase, GHR1, mediates abscisic acid- and hydrogen peroxide-regulated stomatal movement in Arabidopsis.2012 · DOI: 10.1105/tpc.112.100107
A Dominant Mutation in the HT1 Kinase Uncovers Roles of MAP Kinases and GHR1 in CO2-Induced Stomatal Closure.2016 · DOI: 10.1105/tpc.16.00131
Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514
The Receptor-like Pseudokinase GHR1 Is Required for Stomatal Closure.2018 · DOI: 10.1105/tpc.18.00441
At1g08590 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014166 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009745 sucrose mediated signaling Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0030154 cell differentiation Biological Process
GO:0071244 cellular response to carbon dioxide Biological Process
GO:0071485 cellular response to absence of light Biological Process
KEGG gene cross-reference
ath:AT1G08590
ath:AT4G20940
ath:AT5G10020
gmx:732625
mtr:11439632
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860
Rank 1 · LXL04_014166 · OH-1004
Endoplasmic reticulum0.078
Rank 2 · LXL04_014166 · OH-1004
Cytoplasm0.068
Rank 3 · LXL04_014166 · OH-1004
Nucleus0.056
Rank 4 · LXL04_014166 · OH-1004
Lysosome / Vacuole0.025
Rank 5 · LXL04_014166 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_221-66 aa
PF23598.2LRR_1489-204 aa
PF12799.14LRR_495-129 aa
PF13855.13LRR_8144-201 aa
PF12799.14LRR_4244-278 aa
PF23598.2LRR_14451-528 aa
PF13855.13LRR_8463-523 aa
PF00069.32Pkinase764-1032 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_014166PF08263.18LRRNT_221663.3e-0628.0
LXL04_014166PF23598.2LRR_14892049.3e-1864.8
LXL04_014166PF12799.14LRR_4951297.9e-30102.9
LXL04_014166PF13855.13LRR_81442011.3e-2176.8
LXL04_014166PF12799.14LRR_42442787.9e-30102.9
LXL04_014166PF23598.2LRR_144515289.3e-1864.8
LXL04_014166PF13855.13LRR_84635231.3e-2176.8
LXL04_014166PF00069.32Pkinase76410321.4e-2797.5
LXL04_014166PF07714.24PK_Tyr_Ser-Thr7649603.6e-2486.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q0WR59Arabidopsis thalianaProbable inactive receptor kinase At5g1002058.485%Swiss-Protstrong database homology
C0LGQ9Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase GHR141.033%Swiss-Protmoderate database homology
Q9FRS6Arabidopsis thalianaLeucine-rich repeat receptor-like protein kinase PXL127.746%Swiss-Protweak database homology

JBrowse

View in Genome Browser