LXL04_014016 | RubberDandelionOmics

Gene overview

LXL04_014016

Reference: OH-1004 Chr: Chr03 Coordinates: 40595289-40598886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1449 bp · LXL04_014016|LXL04_014016|OH1004|cDNA

ATGAACGGTGATTCACACGAAGCCCCCAAAAATGAAAAGGTTATAGAGATCGAAGATGGTGATGATCACGAGGACCAATCGTCTCCGAGAGGTGTGTTGGAAATCCCCGTATCAGGTTCGGATTCCGATAATCAGAGCAGCCTAAGCAGGAGCCTCAGCAGCCGCGGTTCGTCTTTCAATGATAAATCTCCGGATGGAGAAGTTGATTCGGCTACCGAGGAGGAAGGTAGCGGCGGAGCGGAGGTTGTCAACTCTTCGGC...

CDS

Download CDS FASTA

1449 bp · LXL04_014016|LXL04_014016|OH1004|CDS

ATGAACGGTGATTCACACGAAGCCCCCAAAAATGAAAAGGTTATAGAGATCGAAGATGGTGATGATCACGAGGACCAATCGTCTCCGAGAGGTGTGTTGGAAATCCCCGTATCAGGTTCGGATTCCGATAATCAGAGCAGCCTAAGCAGGAGCCTCAGCAGCCGCGGTTCGTCTTTCAATGATAAATCTCCGGATGGAGAAGTTGATTCGGCTACCGAGGAGGAAGGTAGCGGCGGAGCGGAGGTTGTCAACTCTTCGGC...

Protein

Download Protein FASTA

482 aa · LXL04_014016|LXL04_014016|OH1004|PROTEIN

MNGDSHEAPKNEKVIEIEDGDDHEDQSSPRGVLEIPVSGSDSDNQSSLSRSLSSRGSSFNDKSPDGEVDSATEEEGSGGAEVVNSSATAHGLQWRNLVDNLKWKSIKRLSALPLMAGYELSRKSLMKRLGKNQSIEDTIEGGNWAVPKPSWRNFTLEELATATDNFSSGNLVGRGGHADVYKGLLPDGQLVAVKRITKKEKKDEDRVGDFLSELGIIAHINHPNAARLIGFSSDTDLHLVLQFAPHGSLATLLHNSEERL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014016`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014016

Location Chr03:40595289-40598886 (-)

Description Similar to RBK1: Receptor-like cytosolic serine/threonine-protein kinase RBK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release
`At2g18470`	Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels.	Plasma membrane-associated proline-rich extensin-like receptor kinase 4, a novel regulator of Ca signalling, is required for abscisic acid responses in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03956.x Arabidopsis proline-rich extensin-like receptor kinase 4 modulates the early event toward abscisic acid response in root tip growth.2009 · DOI: 10.4161/psb.4.11.9739

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014016 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G52290

ath:AT2G18470

ath:AT3G05140

ath:AT5G10520

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.718

Rank 1 · LXL04_014016 · OH-1004

Nucleus0.222

Rank 2 · LXL04_014016 · OH-1004

Cytoplasm0.211

Rank 3 · LXL04_014016 · OH-1004

Endoplasmic reticulum0.041

Rank 4 · LXL04_014016 · OH-1004

Golgi apparatus0.026

Rank 5 · LXL04_014016 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase168-378 aa

PF07714.24PK_Tyr_Ser-Thr170-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014016	`PF00069.32`	Pkinase	168	378	3.8e-39	135.4
LXL04_014016	`PF07714.24`	PK_Tyr_Ser-Thr	170	433	9.3e-41	140.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1D6`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK1	58.794%	Swiss-Prot	strong database homology
`Q8RXC8`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK2	45.474%	Swiss-Prot	moderate database homology
`Q5XF57`	Arabidopsis thaliana	Probable receptor-like serine/threonine-protein kinase At5g57670	49.153%	Swiss-Prot	moderate database homology
`Q9C821`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK15	39.143%	Swiss-Prot	moderate database homology
`Q9ZNQ8`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK4	40.708%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card