LXL04_013656 | RubberDandelionOmics

Gene overview

LXL04_013656

Reference: OH-1004 Chr: Chr03 Coordinates: 33652241-33653368 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · LXL04_013656|LXL04_013656|OH1004|cDNA

ATGGCATCATCGGAAGAACCGGATAGCAACGCCTCCATGTCCCAACCCTACAAACTAAAGCAAACCCTCACTGGCCACAAACGCTCCATTTCCAGCGTCAAATTCTCCGACGATGGCAAGCTAATCGCCACTTGTTCCGCCGACAAGACCGCCCGCACATGGTCCACCTCCGATGGATCTCCTCTCCAAGAATTCGTCGGCCATGAGCAAGGAATCTCAGACGTCGCATTCTCCTCCGACGCTCGGTACCTGGCGACCGC...

CDS

Download CDS FASTA

996 bp · LXL04_013656|LXL04_013656|OH1004|CDS

ATGGCATCATCGGAAGAACCGGATAGCAACGCCTCCATGTCCCAACCCTACAAACTAAAGCAAACCCTCACTGGCCACAAACGCTCCATTTCCAGCGTCAAATTCTCCGACGATGGCAAGCTAATCGCCACTTGTTCCGCCGACAAGACCGCCCGCACATGGTCCACCTCCGATGGATCTCCTCTCCAAGAATTCGTCGGCCATGAGCAAGGAATCTCAGACGTCGCATTCTCCTCCGACGCTCGGTACCTGGCGACCGC...

Protein

Download Protein FASTA

331 aa · LXL04_013656|LXL04_013656|OH1004|PROTEIN

MASSEEPDSNASMSQPYKLKQTLTGHKRSISSVKFSDDGKLIATCSADKTARTWSTSDGSPLQEFVGHEQGISDVAFSSDARYLATASDDKTVRLWDVCTGSLVKTLTGHTNYVFCVNYNPQSNMIVSGSFDETVRVWDVKTGKCLKVLPAHSDPVTAVNFNRDGTLIVSSSYDGLCRIWDASTGHCMKTLIDDENPPVSFVKFSPNGKFILVGTLDSTLRLWNLSTGKFLKTYSGHTNSKYCISSAFSITNGKYIVSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013656`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013656

Location Chr03:33652241-33653368 (+)

Description Similar to WDR5A: COMPASS-like H3K4 histone methylase component WDR5A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49660`	Forms multiple COMPASS-like complexes involved in histone methylation by interacting with different histone H3 'Lys-4' methyltransferases such as ATX1, SDG14 or SDG16.	Establishment of the winter-annual growth habit via FRIGIDA-mediated histone methylation at FLOWERING LOCUS C in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067967

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013656 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0018022 peptidyl-lysine methylation Biological Process

GO:0032259 methylation Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT3G49660

bta:100125836

hsa:11091

mmu:140858

rno:362093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.716

Rank 1 · LXL04_013656 · OH-1004

Cytoplasm0.315

Rank 2 · LXL04_013656 · OH-1004

Cell membrane0.036

Rank 3 · LXL04_013656 · OH-1004

Mitochondrion0.031

Rank 4 · LXL04_013656 · OH-1004

Lysosome / Vacuole0.026

Rank 5 · LXL04_013656 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24105.2Beta-prop_CAF1B_HIR110-101 aa

PF24797.2Beta-prop_WDR35_TULP_N11-146 aa

PF24782.3WD40_MABP1-WDR62_2nd13-180 aa

PF24807.2WD40_CDC20-Fz17-69 aa

PF00400.39WD4018-55 aa

PF23381.2Beta-prop_IFT122_1st18-89 aa

PF24814.2WD40_Prp1918-106 aa

PF25173.2Beta-prop_WDR3_1st18-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013656	`PF24105.2`	Beta-prop_CAF1B_HIR1	10	101	2.4e-35	122.9
LXL04_013656	`PF24797.2`	Beta-prop_WDR35_TULP_N	11	146	3.5e-10	40.3
LXL04_013656	`PF24782.3`	WD40_MABP1-WDR62_2nd	13	180	1.1e-28	101.0
LXL04_013656	`PF24807.2`	WD40_CDC20-Fz	17	69	4.8e-48	164.7
LXL04_013656	`PF00400.39`	WD40	18	55	5.2e-79	258.1
LXL04_013656	`PF23381.2`	Beta-prop_IFT122_1st	18	89	2e-73	247.8
LXL04_013656	`PF24814.2`	WD40_Prp19	18	106	1.9e-68	231.3
LXL04_013656	`PF25173.2`	Beta-prop_WDR3_1st	18	111	2.5e-68	230.1
LXL04_013656	`PF24817.2`	WD40_WDHD1_1st	18	108	5.4e-58	197.2
LXL04_013656	`PF25172.2`	Beta-prop_WDR3_2nd	18	139	4.6e-49	167.9
LXL04_013656	`PF24796.2`	WDR55	18	144	1.2e-34	120.5
LXL04_013656	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	18	206	7.7e-26	91.8
LXL04_013656	`PF23393.3`	Beta-prop_WDR90_POC16_2nd	19	82	3.2e-28	99.5
LXL04_013656	`PF25391.2`	WD40_Gbeta	20	99	7.6e-37	127.8
LXL04_013656	`PF24780.2`	WD40_MABP1-WDR62_1st	20	86	9.3e-30	104.7
LXL04_013656	`PF30552.1`	CFAP251_N	21	98	7.8e-22	78.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z2`	Arabidopsis thaliana	COMPASS-like H3K4 histone methylase component WDR5A	73.817%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card