LXL04_013231 | RubberDandelionOmics

Gene overview

LXL04_013231

Reference: OH-1004 Chr: Chr03 Coordinates: 26335574-26341427 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3657 bp · LXL04_013231|LXL04_013231|OH1004|cDNA

ATGGTAGCAGTGTTGGTGTATAGCGTACCGGTGGTGGTAGCGGTTGTAGGAAGCAACTtcgtggtggtggtggtggtaggTGGCAACGTTGAGGCCCCATCAATACATACAGGACGTGATGGAACCGACCGTTGTAATAAAACCACCAACAGCCTCCGCCGGGAAATGGACATACTCTTCGCTCAGATCCAAGCGGATCTCCGCTCCAACGACGCCCTCCGCCAATCAGGGGCACTACTTCAGGCACTTCAACAATCTGC...

CDS

Download CDS FASTA

3657 bp · LXL04_013231|LXL04_013231|OH1004|CDS

ATGGTAGCAGTGTTGGTGTATAGCGTACCGGTGGTGGTAGCGGTTGTAGGAAGCAACTTCGTGGTGGTGGTGGTGGTAGGTGGCAACGTTGAGGCCCCATCAATACATACAGGACGTGATGGAACCGACCGTTGTAATAAAACCACCAACAGCCTCCGCCGGGAAATGGACATACTCTTCGCTCAGATCCAAGCGGATCTCCGCTCCAACGACGCCCTCCGCCAATCAGGGGCACTACTTCAGGCACTTCAACAATCTGC...

Protein

Download Protein FASTA

1218 aa · LXL04_013231|LXL04_013231|OH1004|PROTEIN

MVAVLVYSVPVVVAVVGSNFVVVVVVGGNVEAPSIHTGRDGTDRCNKTTNSLRREMDILFAQIQADLRSNDALRQSGALLQALQQSAAGRDISVIAKSAVEEIVASPASAVSKKLAFDLIRSTRLTTDLWEIVCTGIHNDLEFPDPDVTAAAVSILAAIPSYRLGKLITDSNKEISSCFDSTSDNLRFSITETLGCILARDDLVTLCENNINLLDKVSNWWTRIGQNMLDRADNVSKVAFESVGRLFQEFESKRMSRLAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013231`
TK1151 ID	TkA02G510640
OH-1004 ID	LXL04_013231
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 95.484 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013231

Location Chr03:26335574-26341427 (-)

Description Similar to TPLATE: Protein TPLATE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01780`	Functions in vesicle-trafficking events required for site- specific cell wall modifications during pollen germination and for anchoring of the cell plate to the mother wall at the correct cortical position.	Somatic cytokinesis and pollen maturation in Arabidopsis depend on TPLATE, which has domains similar to coat proteins.2006 · DOI: 10.1105/tpc.106.040923

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013231 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006897 endocytosis Biological Process

GO:0009555 pollen development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G01780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.480

Rank 1 · LXL04_013231 · OH-1004

Nucleus0.407

Rank 2 · LXL04_013231 · OH-1004

Golgi apparatus0.086

Rank 3 · LXL04_013231 · OH-1004

Cell membrane0.074

Rank 4 · LXL04_013231 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_013231 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28665.1TPLATE_Ig824-964 aa

PF28631.1TPLATE_C971-1128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013231	`PF28665.1`	TPLATE_Ig	824	964	8.4e-71	237.0
LXL04_013231	`PF28631.1`	TPLATE_C	971	1128	1.2e-77	259.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J8D3`	Arabidopsis thaliana	Protein TPLATE	79.608%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card