LXL04_012802 | RubberDandelionOmics

Gene overview

LXL04_012802

Reference: OH-1004 Chr: Chr03 Coordinates: 19105509-19105964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · LXL04_012802|LXL04_012802|OH1004|cDNA

ATGGAGGGCGCAAACGATACCGGAGAACCATCCTTTAACGGCGGTGAAGACTGCTGCGGTGTTGGAGTTAACTACGCACTTGGTTTCTACTTCATCTTCCTCCTTTTCGTATTCACCCTCTGCTATACTTCTTACATCTGCAACCGCACCATACGCTCTCAAATATCATCACCGACCACCACTAGTGACGGTGGTGACGACGACTATCATATTATAAGATTACCCCCTCAAGGTCTTTGCGATGACGTCCTTTCCACTTT...

CDS

Download CDS FASTA

456 bp · LXL04_012802|LXL04_012802|OH1004|CDS

ATGGAGGGCGCAAACGATACCGGAGAACCATCCTTTAACGGCGGTGAAGACTGCTGCGGTGTTGGAGTTAACTACGCACTTGGTTTCTACTTCATCTTCCTCCTTTTCGTATTCACCCTCTGCTATACTTCTTACATCTGCAACCGCACCATACGCTCTCAAATATCATCACCGACCACCACTAGTGACGGTGGTGACGACGACTATCATATTATAAGATTACCCCCTCAAGGTCTTTGCGATGACGTCCTTTCCACTTT...

Protein

Download Protein FASTA

151 aa · LXL04_012802|LXL04_012802|OH1004|PROTEIN

MEGANDTGEPSFNGGEDCCGVGVNYALGFYFIFLLFVFTLCYTSYICNRTIRSQISSPTTTSDGGDDDYHIIRLPPQGLCDDVLSTFPTFLYSDVMIPGSACSICLADYKPPDVLRLLPECSHLFHSSCIDTWLKMHPTCPVCRNSFDFSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012802`
TK1151 ID	TkA02G537510
OH-1004 ID	LXL04_012802
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.800
Protein coverage (%)	TK1151 93.865 / OH-1004 96.689 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012802

Location Chr03:19105509-19105964 (+)

Description Similar to ATL71: Putative RING-H2 finger protein ATL71

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06490`	Putative RING-H2 finger protein ATL71.	No verified direct reference in this release
`At1g35330`	RING-H2 finger protein ATL34.	No verified direct reference in this release
`At2g35910`	RING-H2 finger protein ATL70.	No verified direct reference in this release
`At2g35000`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	No verified direct reference in this release
`At3g61550`	RING-H2 finger protein ATL68.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012802 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010200 response to chitin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G35000

ath:AT2G35910

ath:AT3G61550

ath:AT5G06490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.351

Rank 1 · LXL04_012802 · OH-1004

Endoplasmic reticulum0.262

Rank 2 · LXL04_012802 · OH-1004

Cell membrane0.236

Rank 3 · LXL04_012802 · OH-1004

Cytoplasm0.191

Rank 4 · LXL04_012802 · OH-1004

Golgi apparatus0.137

Rank 5 · LXL04_012802 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2101-144 aa

PF17123.12zf-RING_11102-130 aa

PF00097.32zf-C3HC4102-143 aa

PF13923.13zf-C3HC4_2102-143 aa

PF13445.13zf-RING_UBOX102-141 aa

PF12678.14zf-rbx1114-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012802	`PF13639.13`	zf-RING_2	101	144	2.8e-15	57.0
LXL04_012802	`PF17123.12`	zf-RING_11	102	130	3.9e-10	40.0
LXL04_012802	`PF00097.32`	zf-C3HC4	102	143	1.7e-09	38.1
LXL04_012802	`PF13923.13`	zf-C3HC4_2	102	143	2e-08	34.6
LXL04_012802	`PF13445.13`	zf-RING_UBOX	102	141	6.7e-08	33.1
LXL04_012802	`PF12678.14`	zf-rbx1	114	144	1.6e-07	32.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG21`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL71	36.184%	Swiss-Prot	moderate database homology
`Q9C7I1`	Arabidopsis thaliana	RING-H2 finger protein ATL34	39.200%	Swiss-Prot	moderate database homology
`Q8RX29`	Arabidopsis thaliana	RING-H2 finger protein ATL70	42.759%	Swiss-Prot	moderate database homology
`O64763`	Arabidopsis thaliana	E3 ubiquitin-protein ligase ATL9	36.885%	Swiss-Prot	moderate database homology
`Q9M313`	Arabidopsis thaliana	RING-H2 finger protein ATL68	31.847%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card