LXL04_012670 | RubberDandelionOmics

Gene overview

LXL04_012670

Reference: OH-1004 Chr: Chr03 Coordinates: 16626713-16629327 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1449 bp · LXL04_012670|LXL04_012670|OH1004|cDNA

ATGAAGATACTGAAAATGGTGTCTGCCATGGATCTGGTAGCATGGAGAGGTTTCGTATACACTTTATTCATACTCCACTTCGTATTCGCTTGCCAACTCCTTCTGCTCCAACCCCTCGTTTCTGCCCTAGATGGAAAATCCGGTGATACTGCTGAATTGTTTGAAAGAGTTTCACATAGCATAAAAGTTAAACATTATAGCGAGGCAATCAATGATCTTAACACTGCCATAGAGGCCGATCCATCGCTTTCAGAAGCATA...

CDS

Download CDS FASTA

1449 bp · LXL04_012670|LXL04_012670|OH1004|CDS

ATGAAGATACTGAAAATGGTGTCTGCCATGGATCTGGTAGCATGGAGAGGTTTCGTATACACTTTATTCATACTCCACTTCGTATTCGCTTGCCAACTCCTTCTGCTCCAACCCCTCGTTTCTGCCCTAGATGGAAAATCCGGTGATACTGCTGAATTGTTTGAAAGAGTTTCACATAGCATAAAAGTTAAACATTATAGCGAGGCAATCAATGATCTTAACACTGCCATAGAGGCCGATCCATCGCTTTCAGAAGCATA...

Protein

Download Protein FASTA

482 aa · LXL04_012670|LXL04_012670|OH1004|PROTEIN

MKILKMVSAMDLVAWRGFVYTLFILHFVFACQLLLLQPLVSALDGKSGDTAELFERVSHSIKVKHYSEAINDLNTAIEADPSLSEAYWKRASVLRQLCRYEESEKSYKKFLELKPGNPTVEKELSQLHQAHSALDSANNLFLSADYTKALDFIDKVVLIFSPACSQAKLLKVKLLLANKDYAGVISEAGYILKEDEDNLEALLLRGRAYYYLADHDVATRHYQKGLRSDPEHSELKKAYFGLKNLLKKTKSAEENAKKGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012670`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012670

Location Chr03:16626713-16629327 (+)

Description Similar to P58IPK: DnaJ protein P58IPK homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03160`	Plays an important positive role in viral symptom development and is required for viral multiplication and pathogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0977200`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312
`Os02g0195300`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012670 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0034975 protein folding in endoplasmic reticulum Biological Process

GO:0036494 positive regulation of translation initiation in response to endoplasmic reticulum stress Biological Process

GO:0044794 host-mediated activation of viral process Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0051607 defense response to virus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:1902010 negative regulation of translation in response to endoplasmic reticulum stress Biological Process

GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT5G03160

bta:286770

dosa:Os01g0977200

dosa:Os02g0195300

hsa:5611

osa:4327812

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.510

Rank 1 · LXL04_012670 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_012670 · OH-1004

Nucleus0.130

Rank 3 · LXL04_012670 · OH-1004

Golgi apparatus0.106

Rank 4 · LXL04_012670 · OH-1004

Mitochondrion0.100

Rank 5 · LXL04_012670 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13432.13TPR_1665-118 aa

PF13414.13TPR_1166-94 aa

PF07719.24TPR_285-117 aa

PF14559.13TPR_19258-316 aa

PF00226.37DnaJ371-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012670	`PF13432.13`	TPR_16	65	118	1.5e-16	61.2
LXL04_012670	`PF13414.13`	TPR_11	66	94	8.9e-14	51.6
LXL04_012670	`PF07719.24`	TPR_2	85	117	3.5e-21	74.2
LXL04_012670	`PF14559.13`	TPR_19	258	316	8e-15	55.6
LXL04_012670	`PF00226.37`	DnaJ	371	434	4e-26	91.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYW9`	Arabidopsis thaliana	DnaJ protein P58IPK homolog	74.286%	Swiss-Prot	strong database homology
`Q5JNB5`	Oryza sativa subsp. japonica	DnaJ protein P58IPK homolog B	69.652%	Swiss-Prot	strong database homology
`A0A0P0VG31`	Oryza sativa subsp. japonica	DnaJ protein P58IPK homolog A	68.372%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card