RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_011415
Reference: OH-1004 Chr: Chr02 Coordinates: 163963943-163967122 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1278 bp · LXL04_011415|LXL04_011415|OH1004|cDNA

ATGCAGACAAGGAAAGTAGAAATCAAACCTGTCAAAGGGGTACCGGAACTGGTCGCCGGTCGTCGGTCGTCGAAGAAAGGAAGCGAGATAGAAACGTGGTCGGTCGTCGCCTGcccaaaacccggacggaatgggaaaaactCGGACGGAATGAGACCGGATGGAAAAATCAGAACCCGGATagaatgggaaaaacccggacgaaatTGTTTAAACCCGGATGAGCTTCTAAAACCTCGAAATGGGCCTGACCAAAACCC...

CDS

Download CDS FASTA

1278 bp · LXL04_011415|LXL04_011415|OH1004|CDS

ATGCAGACAAGGAAAGTAGAAATCAAACCTGTCAAAGGGGTACCGGAACTGGTCGCCGGTCGTCGGTCGTCGAAGAAAGGAAGCGAGATAGAAACGTGGTCGGTCGTCGCCTGCCCAAAACCCGGACGGAATGGGAAAAACTCGGACGGAATGAGACCGGATGGAAAAATCAGAACCCGGATAGAATGGGAAAAACCCGGACGAAATTGTTTAAACCCGGATGAGCTTCTAAAACCTCGAAATGGGCCTGACCAAAACCC...

Protein

Download Protein FASTA

425 aa · LXL04_011415|LXL04_011415|OH1004|PROTEIN

MQTRKVEIKPVKGVPELVAGRRSSKKGSEIETWSVVACPKPGRNGKNSDGMRPDGKIRTRIEWEKPGRNCLNPDELLKPRNGPDQNPDRNFYPVKMVCLRVHAAVSLVILLHFLFNVAVDCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIIGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKKLTHLYLSFNSFKGEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_011415
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_011415
LocationChr02:163963943-163967122 (+)
DescriptionSimilar to RLP35: Receptor-like protein 35
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g11080 Receptor-like protein 35. No verified direct reference in this release
At4g20140 Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x
The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066
A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
At1g35710 Probable leucine-rich repeat receptor-like protein kinase At1g35710. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0917500 Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.
The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401
Os04g0576900 Functions in the early stages of organ development by regulating cell division rate.
XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011415 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT3G11080
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.387
Rank 1 · LXL04_011415 · OH-1004
Extracellular0.168
Rank 2 · LXL04_011415 · OH-1004
Cytoplasm0.140
Rank 3 · LXL04_011415 · OH-1004
Endoplasmic reticulum0.129
Rank 4 · LXL04_011415 · OH-1004
Nucleus0.105
Rank 5 · LXL04_011415 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8189-232 aa
PF23598.2LRR_14192-300 aa
PF13855.13LRR_8198-255 aa
PF12799.14LRR_4198-234 aa
PF12799.14LRR_4244-284 aa
PF13855.13LRR_8265-304 aa
PF12799.14LRR_4270-311 aa
PF13855.13LRR_8320-379 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_011415PF13855.13LRR_81892324.6e-32110.3
LXL04_011415PF23598.2LRR_141923001.4e-1660.9
LXL04_011415PF13855.13LRR_81982554.6e-32110.3
LXL04_011415PF12799.14LRR_41982345.3e-30103.5
LXL04_011415PF12799.14LRR_42442845.3e-30103.5
LXL04_011415PF13855.13LRR_82653044.6e-32110.3
LXL04_011415PF12799.14LRR_42703115.3e-30103.5
LXL04_011415PF13855.13LRR_83203794.6e-32110.3
LXL04_011415PF12799.14LRR_43213545.3e-30103.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SRL7Arabidopsis thalianaReceptor-like protein 3536.042%Swiss-Protmoderate database homology
C0LGQ5Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase GSO134.853%Swiss-Protmoderate database homology
Q9LP24Arabidopsis thalianaProbable leucine-rich repeat receptor-like protein kinase At1g3571035.088%Swiss-Protmoderate database homology
Q8RZV7Oryza sativa subsp. japonicaLeucine-rich repeat receptor protein kinase MSP132.673%Swiss-Protmoderate database homology
G9LZD7Oryza sativa subsp. japonicaProbable inactive leucine-rich repeat receptor kinase XIAO38.961%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser