LXL04_011330 | RubberDandelionOmics

Gene overview

LXL04_011330

Reference: OH-1004 Chr: Chr02 Coordinates: 162587146-162588963 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · LXL04_011330|LXL04_011330|OH1004|cDNA

ATGGAAGAAGGAGTTCGTACCTCAATCGATTGTGGTGGAGTTGTGGGGAAACTGAAAGGAAGAACTCGTTTGATGAATTGTATCGTTGGACTGAGAAAGACCCGTTGGAGCAGCGAACGAAAGGAGGAACGCCGCGTTCCTCTGCGTTGGAAAAACGACGCCAGGCAACGCCAAGAAGGGAAACGCCGACCCAGGCGCGGTGTGCCAAGCCCCACAACGACGTTCTGCCCTCCACCTCAGCCGCGTTCTCTTTGGCGTCG...

CDS

Download CDS FASTA

978 bp · LXL04_011330|LXL04_011330|OH1004|CDS

ATGGAAGAAGGAGTTCGTACCTCAATCGATTGTGGTGGAGTTGTGGGGAAACTGAAAGGAAGAACTCGTTTGATGAATTGTATCGTTGGACTGAGAAAGACCCGTTGGAGCAGCGAACGAAAGGAGGAACGCCGCGTTCCTCTGCGTTGGAAAAACGACGCCAGGCAACGCCAAGAAGGGAAACGCCGACCCAGGCGCGGTGTGCCAAGCCCCACAACGACGTTCTGCCCTCCACCTCAGCCGCGTTCTCTTTGGCGTCG...

Protein

Download Protein FASTA

325 aa · LXL04_011330|LXL04_011330|OH1004|PROTEIN

MEEGVRTSIDCGGVVGKLKGRTRLMNCIVGLRKTRWSSERKEERRVPLRWKNDARQRQEGKRRPRRGVPSPTTTFCPPPQPRSLWRRPTPYSLSAIFFLVIENLDKIFYPGFGQAHFEFLEAHPGFNKSIRIATFFWKSSLVRRPHLRSDHHSDDLHSDATSTPTTSTTSYTSLSSLSLLFLRRRPTGIFLLSFLCFNLTPVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011330`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011330

Location Chr02:162587146-162588963 (-)

Description Similar to UBICEP52-7: Ubiquitin-60S ribosomal protein L40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52590`	Exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release
`At2g36170`	Exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0568400`	Exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release
`Os03g0234200`	Exists either covalently attached to another protein, or free (unanchored).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011330 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0019941 modification-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

KEGG gene cross-reference

ath:AT2G36170

ath:AT3G52590

dosa:Os03g0234200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.453

Rank 1 · LXL04_011330 · OH-1004

Cytoplasm0.392

Rank 2 · LXL04_011330 · OH-1004

Mitochondrion0.120

Rank 3 · LXL04_011330 · OH-1004

Cell membrane0.093

Rank 4 · LXL04_011330 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_011330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin202-271 aa

PF11976.15Rad60-SLD202-268 aa

PF01020.24Ribosomal_L40e275-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011330	`PF00240.30`	ubiquitin	202	271	1.5e-30	105.5
LXL04_011330	`PF11976.15`	Rad60-SLD	202	268	4.6e-15	55.9
LXL04_011330	`PF01020.24`	Ribosomal_L40e	275	324	2.1e-28	98.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42202`	Arabidopsis thaliana	Ubiquitin-ribosomal protein eL40y fusion protein	97.581%	Swiss-Prot	weak database homology
`B9DHA6`	Arabidopsis thaliana	Ubiquitin-ribosomal protein eL40z fusion protein	97.581%	Swiss-Prot	weak database homology
`P0CH35`	Oryza sativa subsp. japonica	Ubiquitin-ribosomal protein eL40y fusion protein	97.581%	Swiss-Prot	weak database homology
`P0CH34`	Oryza sativa subsp. japonica	Ubiquitin-ribosomal protein eL40z fusion protein	97.581%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card