LXL04_011284 | RubberDandelionOmics

Gene overview

LXL04_011284

Reference: OH-1004 Chr: Chr02 Coordinates: 162012355-162015181 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · LXL04_011284|LXL04_011284|OH1004|cDNA

ATGGGAGGTTCGAAGACGGAAGGGGCAACCTCTTCCTCAACCCCTGTAATTGCAAATCGTAGAGACCCATATGAGGTTTTGAGTGTCTCAAGAGATGCTTCTGATCAGGAGATTAAATCCGCTTACAGAAAACTTGCTCTCAAATATCATCCTGATAAAAACGCTAGTAACCCCGAAGCCTCAGAACAATTCAAGGAGGTTGCCTATTCTTACAGCATTCTATCCGATCCAGAAAAAAGAAGGCAATATGATAACGCTGG...

CDS

Download CDS FASTA

1254 bp · LXL04_011284|LXL04_011284|OH1004|CDS

ATGGGAGGTTCGAAGACGGAAGGGGCAACCTCTTCCTCAACCCCTGTAATTGCAAATCGTAGAGACCCATATGAGGTTTTGAGTGTCTCAAGAGATGCTTCTGATCAGGAGATTAAATCCGCTTACAGAAAACTTGCTCTCAAATATCATCCTGATAAAAACGCTAGTAACCCCGAAGCCTCAGAACAATTCAAGGAGGTTGCCTATTCTTACAGCATTCTATCCGATCCAGAAAAAAGAAGGCAATATGATAACGCTGG...

Protein

Download Protein FASTA

417 aa · LXL04_011284|LXL04_011284|OH1004|PROTEIN

MGGSKTEGATSSSTPVIANRRDPYEVLSVSRDASDQEIKSAYRKLALKYHPDKNASNPEASEQFKEVAYSYSILSDPEKRRQYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISASVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEEQAQSGIVVRVSSAAQSKFKLLYFEQDNGGGYSLALQEDSEKTGKATSAGMYFLHFQVYRMDSTVNAFEMAKDPEAAFFKRLEGLQPCEVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011284`
TK1151 ID	TkA03G580670
OH-1004 ID	LXL04_011284
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011284

Location Chr02:162012355-162015181 (-)

Description Similar to ATJ15: Chaperone protein dnaJ 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68370`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release
`At1g24120`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release
`At1g59980`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011284 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0042026 protein refolding Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008092 cytoskeletal protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G24120

ath:AT1G59980

ath:AT1G68370

mfa:Mfla_0750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · LXL04_011284 · OH-1004

Nucleus0.250

Rank 2 · LXL04_011284 · OH-1004

Golgi apparatus0.184

Rank 3 · LXL04_011284 · OH-1004

Endoplasmic reticulum0.153

Rank 4 · LXL04_011284 · OH-1004

Cell membrane0.107

Rank 5 · LXL04_011284 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ22-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011284	`PF00226.37`	DnaJ	22	84	7.7e-28	97.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSY2`	Arabidopsis thaliana	Chaperone protein dnaJ 15	77.488%	Swiss-Prot	strong database homology
`Q8VXV4`	Arabidopsis thaliana	Chaperone protein dnaJ 16	57.212%	Swiss-Prot	strong database homology
`Q6XL73`	Arabidopsis thaliana	Chaperone protein dnaJ 39	52.417%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card