LXL04_011251 | RubberDandelionOmics

Gene overview

LXL04_011251

Reference: OH-1004 Chr: Chr02 Coordinates: 161121874-161122875 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_011251|LXL04_011251|OH1004|cDNA

ATGGCGGATATCCGGAAGCAATTGAATCAAGAAAATGTATGCAACAAAAAACCCAGAAAGAGAGGAAAGATACTCGAATCAAGTATCAGCATTCCGATGAGAACTATTCGGATCATATGTCACGACCCTTATATGACGGAATCTTCCGATGAAGACGAACCCACCAGAAAACTCAACCCGTCTAAAGTTATTGTTCGGGAAATCAAGATTCCGGTGACCGAAGGCTGTGAAACGAAAACTCCGGTGACTGAAGGTTCTTG...

CDS

Download CDS FASTA

1002 bp · LXL04_011251|LXL04_011251|OH1004|CDS

ATGGCGGATATCCGGAAGCAATTGAATCAAGAAAATGTATGCAACAAAAAACCCAGAAAGAGAGGAAAGATACTCGAATCAAGTATCAGCATTCCGATGAGAACTATTCGGATCATATGTCACGACCCTTATATGACGGAATCTTCCGATGAAGACGAACCCACCAGAAAACTCAACCCGTCTAAAGTTATTGTTCGGGAAATCAAGATTCCGGTGACCGAAGGCTGTGAAACGAAAACTCCGGTGACTGAAGGTTCTTG...

Protein

Download Protein FASTA

333 aa · LXL04_011251|LXL04_011251|OH1004|PROTEIN

MADIRKQLNQENVCNKKPRKRGKILESSISIPMRTIRIICHDPYMTESSDEDEPTRKLNPSKVIVREIKIPVTEGCETKTPVTEGSCHGSNNGDGNLVKGKRVLTKTPSQPQITSGLKYRGVRQRKWGKWAAEIRDPFKGRRVWLGTYNTAEEASKAYEIKKLEFETMAEALKNQNQNKEKNKKSLIIIHSGHQKQSVSEDSVGVTPHASPSSVLEVDSSSPSKILTTTTPTVTTTTSAAAAIDEDFLDKSMDTLSDPGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011251`
TK1151 ID	TkA03G577010
OH-1004 ID	LXL04_011251
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011251

Location Chr02:161121874-161122875 (+)

Description Similar to ERF118: Ethylene-responsive transcription factor ERF118

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68550`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g25890`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g27950`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At1g28370`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release
`At2g47520`	Transcriptional activator that binds specifically to the cis- acting element GCC box 5'-AGCCGCC-3', or to the CRT/DRE element 5'- [AG]CCGAC-3'.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x AtERF71/HRE2 transcription factor mediates osmotic stress response as well as hypoxia response in Arabidopsis.2011 · DOI: 10.1016/j.bbrc.2011.09.039 Homeostatic response to hypoxia is regulated by the N-end rule pathway in plants.2011 · DOI: 10.1038/nature10534 Arabidopsis AtERF71/HRE2 functions as transcriptional activator via cis-acting GCC box or DRE/CRT element and is involved in root development through regulation of root cell expansion.2015 · DOI: 10.1007/s00299-014-1701-9 Hypoxia and the group VII ethylene response transcription factor HRE2 promote adventitious root elongation in Arabidopsis.2019 · DOI: 10.1111/plb.12873 The possible roles of AtERF71 in the defense response against the Fusarium graminearum .2018 · DOI: 10.5511/plantbiotechnology.18.0501b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011251 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0034059 response to anoxia Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048366 leaf development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT1G28370

ath:AT1G68550

ath:AT2G47520

ath:AT3G25890

ath:AT4G27950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_011251 · OH-1004

Cytoplasm0.099

Rank 2 · LXL04_011251 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_011251 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_011251 · OH-1004

Plastid0.014

Rank 5 · LXL04_011251 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2118-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011251	`PF00847.27`	AP2	118	160	1.3e-12	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA27`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF118	32.164%	Swiss-Prot	moderate database homology
`Q9LUA2`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF119	40.141%	Swiss-Prot	weak database homology
`Q9SUE3`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF4	31.915%	Swiss-Prot	moderate database homology
`Q9C5I3`	Arabidopsis thaliana	Ethylene-responsive transcription factor 11	61.538%	Swiss-Prot	weak database homology
`O22259`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF071	40.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card