LXL04_011207 | RubberDandelionOmics

Gene overview

LXL04_011207

Reference: OH-1004 Chr: Chr02 Coordinates: 160000002-160002928 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1949 bp · LXL04_011207|LXL04_011207|OH1004|cDNA

ccaccaccaccaccacatcTTTCTTTCACACAACCAAGCTCACCTTCCAaaccatcaccaccaccaccacctccgcCACCACCATGCTCCCGGTCACCGCCCTCTTCCTACTCCCGCTCCTCTTCTCCCCTTCCATCTCCTTCCCTTTCGACACGGCCTACCACATAGACTGCGGCagctccaccaccaccaccgatAAATTCAACACTACCTGGCTATCTGACCGTTTCTTCACTGCCGGGTCTAATGGTCTCGTTTCT...

CDS

Download CDS FASTA

1866 bp · LXL04_011207|LXL04_011207|OH1004|CDS

ATGCTCCCGGTCACCGCCCTCTTCCTACTCCCGCTCCTCTTCTCCCCTTCCATCTCCTTCCCTTTCGACACGGCCTACCACATAGACTGCGGCAGCTCCACCACCACCACCGATAAATTCAACACTACCTGGCTATCTGACCGTTTCTTCACTGCCGGGTCTAATGGTCTCGTTTCTGAACCGCTTCTCTTCCAATCGTTCCATGAGAAGACGCTTCGCTACTTCCCAATCTCATCTGGTAAAAAGAATTGCTACATTTT...

Protein

Download Protein FASTA

621 aa · LXL04_011207|LXL04_011207|OH1004|PROTEIN

MLPVTALFLLPLLFSPSISFPFDTAYHIDCGSSTTTTDKFNTTWLSDRFFTAGSNGLVSEPLLFQSFHEKTLRYFPISSGKKNCYIFPDLPSGRYYLRTFTVYDNYDGKSHSPSFDLSVEGTLVFSWRSPWEEEISRYGAYSDLIFFTSDGDADVCFYSIATDPPVIGSLELIQIDPASYDPHLTGNDSSILVNYGRLTCGSHQWGPGFSNDPDVFGRAWQSDAKFRSANSIGIKSVTAVRNVINTGTSPNYFPAKLYDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011207`
TK1151 ID	TkA03G572740
OH-1004 ID	LXL04_011207
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.300
Protein coverage (%)	TK1151 87.288 / OH-1004 16.586 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011207

Location Chr02:160000002-160002928 (+)

Description Similar to RLP4: Receptor-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28340`	Receptor-like protein 4.	No verified direct reference in this release
`At2g14440`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440.	No verified direct reference in this release
`At1g51880`	Probable LRR receptor-like serine/threonine-protein kinase At1g51880.	No verified direct reference in this release
`At1g67720`	Probable LRR receptor-like serine/threonine-protein kinase At1g67720.	No verified direct reference in this release
`At1g51810`	Probable LRR receptor-like serine/threonine-protein kinase At1g51810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0042545 cell wall modification Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031252 cell leading edge Cellular Component

GO:0031254 cell trailing edge Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28340

ath:AT1G51810

ath:AT1G51880

ath:AT1G67720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.604

Rank 1 · LXL04_011207 · OH-1004

Extracellular0.117

Rank 2 · LXL04_011207 · OH-1004

Endoplasmic reticulum0.102

Rank 3 · LXL04_011207 · OH-1004

Cytoplasm0.084

Rank 4 · LXL04_011207 · OH-1004

Lysosome / Vacuole0.082

Rank 5 · LXL04_011207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like28-361 aa

PF11721.15Malectin215-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011207	`PF12819.14`	Malectin_like	28	361	8.6e-58	196.9
LXL04_011207	`PF11721.15`	Malectin	215	333	1.7e-15	58.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HWL3`	Arabidopsis thaliana	Receptor-like protein 4	34.050%	Swiss-Prot	moderate database homology
`Q9ZQQ7`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440	26.929%	Swiss-Prot	weak database homology
`Q9FZB1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g51880	28.032%	Swiss-Prot	weak database homology
`C0LGI2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g67720	27.969%	Swiss-Prot	weak database homology
`Q9FZB8`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g51810	25.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card