LXL04_011107 | RubberDandelionOmics

Gene overview

LXL04_011107

Reference: OH-1004 Chr: Chr02 Coordinates: 157974040-157978768 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_011107|LXL04_011107|OH1004|cDNA

atgcaaatgtataaaataTACATAACAAGCTATATTCTTTATGTGGTTAAGGTTATGTGGCCAAGTTTGGTAGCAAGTAAGCTACTCAGGAAAACATTGGGATCAAACAACTTTGTCGCGGATTTCCCGGAAAACACATATTCTTTTCTTGATCTTCCAACGTTGGATCTTGAACCTGTAATGAGTCCTAAGATCATATTTTCTGACCACCATGATACACAAAAGTTCAAGTTTCAAGAAGTGGTTCCTCTAAGAGCCTC...

CDS

Download CDS FASTA

1302 bp · LXL04_011107|LXL04_011107|OH1004|CDS

ATGCAAATGTATAAAATATACATAACAAGCTATATTCTTTATGTGGTTAAGGTTATGTGGCCAAGTTTGGTAGCAAGTAAGCTACTCAGGAAAACATTGGGATCAAACAACTTTGTCGCGGATTTCCCGGAAAACACATATTCTTTTCTTGATCTTCCAACGTTGGATCTTGAACCTGTAATGAGTCCTAAGATCATATTTTCTGACCACCATGATACACAAAAGTTCAAGTTTCAAGAAGTGGTTCCTCTAAGAGCCTC...

Protein

Download Protein FASTA

433 aa · LXL04_011107|LXL04_011107|OH1004|PROTEIN

MQMYKIYITSYILYVVKVMWPSLVASKLLRKTLGSNNFVADFPENTYSFLDLPTLDLEPVMSPKIIFSDHHDTQKFKFQEVVPLRASNVLGPEKKKISMKWNSLIRRTLNKKSHNGCDNNDNLRDKQRTSFRATKGNKSNIDGRMIQQEFRCLISKQMVGLLISVWVRSDLHPFFRNPNVSCVGCGIMGCLGNKGSVSVRFQFHETSFCFVCCHLASGGREGDQKNRNSDAAEILSRTSFPTAIGPSLGLPKKILDHDRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011107`
TK1151 ID	TkA03G565670
OH-1004 ID	LXL04_011107
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 95.050 / OH-1004 58.199 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011107

Location Chr02:157974040-157978768 (-)

Description Similar to IP5P9: Type IV inositol polyphosphate 5-phosphatase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01900`	Has phosphatase activity toward PtdIns(4,5)P2 and at a lower extent toward PtdIns(3,4,5)P3 but not toward Ins(1,4,5)P3.	No verified direct reference in this release
`At5g65090`	May be involved in the regulation of root hairs development.	Genetic interactions during root hair morphogenesis in Arabidopsis.2000 · DOI: 10.1105/tpc.12.10.1961 Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x
`At2g37440`	Type I inositol polyphosphate 5-phosphatase 8.	No verified direct reference in this release
`At2g32010`	Has phosphatase activity toward PtdIns(4,5)P₂ and, more weakly, PtdIns(3,4,5)P₃, but not Ins(1,4,5)P₃.	CVP2- and CVL1-mediated phosphoinositide signaling as a regulator of the ARF GAP SFC/VAN3 in establishment of foliar vein patterns.2009 · DOI: 10.1111/j.1365-313x.2009.03920.x Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.2015 · DOI: 10.1242/dev.118364
`At1g05470`	May have phosphatase activity toward PtdIns(4,5)P₂ and PtdIns(3,4,5)P₃.	Genetic regulation of vascular tissue patterning in Arabidopsis.1999 · DOI: 10.1105/tpc.11.11.2123 Cotyledon vascular pattern2-mediated inositol (1,4,5) triphosphate signal transduction is essential for closed venation patterns of Arabidopsis foliar organs.2004 · DOI: 10.1105/tpc.021030 CVP2- and CVL1-mediated phosphoinositide signaling as a regulator of the ARF GAP SFC/VAN3 in establishment of foliar vein patterns.2009 · DOI: 10.1111/j.1365-313x.2009.03920.x Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.2015 · DOI: 10.1242/dev.118364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011107 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032957 inositol trisphosphate metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0048765 root hair cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G05470

ath:AT2G01900

ath:AT2G32010

ath:AT2G37440

ath:AT5G65090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.341

Rank 1 · LXL04_011107 · OH-1004

Nucleus0.237

Rank 2 · LXL04_011107 · OH-1004

Cell membrane0.168

Rank 3 · LXL04_011107 · OH-1004

Mitochondrion0.122

Rank 4 · LXL04_011107 · OH-1004

Endoplasmic reticulum0.115

Rank 5 · LXL04_011107 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22669.3Exo_endo_phos262-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011107	`PF22669.3`	Exo_endo_phos2	62	377	4.5e-60	204.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIS4`	Arabidopsis thaliana	Type IV inositol polyphosphate 5-phosphatase 9	56.738%	Swiss-Prot	strong database homology
`Q66GQ6`	Arabidopsis thaliana	Type I inositol polyphosphate 5-phosphatase 5	52.419%	Swiss-Prot	moderate database homology
`Q0WT19`	Arabidopsis thaliana	Type I inositol polyphosphate 5-phosphatase 8	45.570%	Swiss-Prot	moderate database homology
`Q0WQ41`	Arabidopsis thaliana	Type IV inositol polyphosphate 5-phosphatase 7	48.929%	Swiss-Prot	moderate database homology
`Q9LR47`	Arabidopsis thaliana	Type IV inositol polyphosphate 5-phosphatase 6	50.385%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card