LXL04_011054 | RubberDandelionOmics

Gene overview

LXL04_011054

Reference: OH-1004 Chr: Chr02 Coordinates: 157142461-157144815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1348 bp · LXL04_011054|LXL04_011054|OH1004|cDNA

AGAGACCTGTAGTATGAGCTTTTCTGGAAACATGGAAGATGAATATGAGAAGTTTATTCGACGTATGAATCCTCCCAGAGTTGTAATCGACAACGACTCCTTAAAAAACGCCACCGTTATTCAGGTGGATAGCGCTAACAAACATGGCATACTTTTAGAAGTCGTACAAGTTCTCACTGATCTTAACTTTATCATCACCAAAGCTTACATAAGTTCCGATGGCGGCTGGTTCATGGATGTTTTCAATGTCACCGATCAAG...

CDS

Download CDS FASTA

1335 bp · LXL04_011054|LXL04_011054|OH1004|CDS

ATGAGCTTTTCTGGAAACATGGAAGATGAATATGAGAAGTTTATTCGACGTATGAATCCTCCCAGAGTTGTAATCGACAACGACTCCTTAAAAAACGCCACCGTTATTCAGGTGGATAGCGCTAACAAACATGGCATACTTTTAGAAGTCGTACAAGTTCTCACTGATCTTAACTTTATCATCACCAAAGCTTACATAAGTTCCGATGGCGGCTGGTTCATGGATGTTTTCAATGTCACCGATCAAGAAGGGAATAAAAT...

Protein

Download Protein FASTA

444 aa · LXL04_011054|LXL04_011054|OH1004|PROTEIN

MSFSGNMEDEYEKFIRRMNPPRVVIDNDSLKNATVIQVDSANKHGILLEVVQVLTDLNFIITKAYISSDGGWFMDVFNVTDQEGNKITSEEVLDYIQKALGSETSFTTSIRSVDVTSSTDHTVIELIGSDRPGLLSELCAVLTHLKCNVLNGEVWTHNTRAASVLQVTDEETNLAITDPKKLSTIKKMLCNVLKGSNKANEAKTVVSHGVTHTERRLHQMMFADRDYERRDECCSEKESQRPDVKVVNWYDKDYSVVTIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011054`
TK1151 ID	TkA03G562740
OH-1004 ID	LXL04_011054
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.886 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011054

Location Chr02:157142461-157144815 (+)

Description Similar to ACR4: ACT domain-containing protein ACR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69040`	May bind amino acids.	No verified direct reference in this release
`At2g03730`	May bind amino acids.	No verified direct reference in this release
`At3g01990`	May bind amino acids.	No verified direct reference in this release
`At1g76990`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484
`At1g12420`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011054 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016597 amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G12420

ath:AT1G69040

ath:AT1G76990

ath:AT2G03730

ath:AT3G01990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.484

Rank 1 · LXL04_011054 · OH-1004

Nucleus0.419

Rank 2 · LXL04_011054 · OH-1004

Cell membrane0.165

Rank 3 · LXL04_011054 · OH-1004

Lysosome / Vacuole0.070

Rank 4 · LXL04_011054 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_011054 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24931.2ACT_ACR9_3rd23-103 aa

PF26956.1ACT_ACR_D130-104 aa

PF24914.2ACR10_N30-88 aa

PF22754.5bHLH-TF_ACT-like_plant32-100 aa

PF01842.32ACT34-86 aa

PF01842.32ACT122-166 aa

PF13740.13ACT_6123-166 aa

PF01842.32ACT340-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011054	`PF24931.2`	ACT_ACR9_3rd	23	103	1.1e-18	67.9
LXL04_011054	`PF26956.1`	ACT_ACR_D1	30	104	2.9e-51	172.0
LXL04_011054	`PF24914.2`	ACR10_N	30	88	3.3e-16	59.2
LXL04_011054	`PF22754.5`	bHLH-TF_ACT-like_plant	32	100	5.8e-14	52.7
LXL04_011054	`PF01842.32`	ACT	34	86	1.8e-27	95.4
LXL04_011054	`PF01842.32`	ACT	122	166	1.8e-27	95.4
LXL04_011054	`PF13740.13`	ACT_6	123	166	8e-08	32.7
LXL04_011054	`PF01842.32`	ACT	340	384	1.8e-27	95.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LJW3`	Arabidopsis thaliana	ACT domain-containing protein ACR4	74.945%	Swiss-Prot	strong database homology
`Q9ZPQ8`	Arabidopsis thaliana	ACT domain-containing protein ACR5	66.446%	Swiss-Prot	strong database homology
`Q9SGA0`	Arabidopsis thaliana	ACT domain-containing protein ACR6	64.213%	Swiss-Prot	strong database homology
`O49285`	Arabidopsis thaliana	ACT domain-containing protein ACR3	54.300%	Swiss-Prot	strong database homology
`Q9LNA5`	Arabidopsis thaliana	ACT domain-containing protein ACR8	48.786%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card