Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1812 bp · LXL04_010892|LXL04_010892|OH1004|cDNA
ATGACCGGAGAAGGGAAGGCGGTGTGTGTTACAGGGGCGTCGGGATACATAGCTTCATGGCTCGTTAAGCATTTGCTTCACCGTGGCTACACAGTTCATGCTACTGTCCGCTCCCTCGGTCAACTTCTCCTTCTTTCTAATTTTGACTTTCCATCTACTGTTCTTCATTTCAAATCCACAGGTTATCAACGCAATTACGATACAATTTCATATGTTGTCAACGCAATTACGATACGATCTCTTCTCAATTTCCATCTGGC...
1812 bp · LXL04_010892|LXL04_010892|OH1004|CDS
ATGACCGGAGAAGGGAAGGCGGTGTGTGTTACAGGGGCGTCGGGATACATAGCTTCATGGCTCGTTAAGCATTTGCTTCACCGTGGCTACACAGTTCATGCTACTGTCCGCTCCCTCGGTCAACTTCTCCTTCTTTCTAATTTTGACTTTCCATCTACTGTTCTTCATTTCAAATCCACAGGTTATCAACGCAATTACGATACAATTTCATATGTTGTCAACGCAATTACGATACGATCTCTTCTCAATTTCCATCTGGC...
Protein
Download Protein FASTA603 aa · LXL04_010892|LXL04_010892|OH1004|PROTEIN
MTGEGKAVCVTGASGYIASWLVKHLLHRGYTVHATVRSLGQLLLLSNFDFPSTVLHFKSTGYQRNYDTISYVVNAITIRSLLNFHLAQLLQPAVNGTLNVLKSAAKVSSLKRVVLTYSIAAVFYDNSKSDSSVVDETWFSDPETCEQKELWYALSKTLAEKAAVKFCEENGLDLVVINPGFVLGPLLQPTLNLTSEEFIALIETGKEVFPGGIYGIVDVRDVAIAHILAFENLEASGRYLMVSAICHSSEIMKIVQKHYP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010892 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010892 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:154949023-154952912 (-) | |||||||||
| Description | Similar to TKPR1: Tetraketide alpha-pyrone reductase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007623 circadian rhythm Biological Process GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0010597 green leaf volatile biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0016621 cinnamoyl-CoA reductase activity Molecular Function | |||||||||
| KEGG gene cross-reference | mtr:11427940 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01370.28Epimerase8-236 aaPF01073.263Beta_HSD10-236 aaPF07993.19NAD_binding_482-189 aaPF01370.28Epimerase290-524 aaPF01073.263Beta_HSD290-520 aaPF07993.19NAD_binding_4290-479 aaPF13460.13NAD_binding_10290-424 aaPF05368.20NmrA290-368 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010892 | PF01370.28 | Epimerase | 8 | 236 | 4.7e-36 | 125.1 |
| LXL04_010892 | PF01073.26 | 3Beta_HSD | 10 | 236 | 1.7e-26 | 93.6 |
| LXL04_010892 | PF07993.19 | NAD_binding_4 | 82 | 189 | 7e-22 | 78.5 |
| LXL04_010892 | PF01370.28 | Epimerase | 290 | 524 | 4.7e-36 | 125.1 |
| LXL04_010892 | PF01073.26 | 3Beta_HSD | 290 | 520 | 1.7e-26 | 93.6 |
| LXL04_010892 | PF07993.19 | NAD_binding_4 | 290 | 479 | 7e-22 | 78.5 |
| LXL04_010892 | PF13460.13 | NAD_binding_10 | 290 | 424 | 4.3e-16 | 60.0 |
| LXL04_010892 | PF05368.20 | NmrA | 290 | 368 | 7.8e-12 | 46.1 |
| LXL04_010892 | PF16363.12 | GDP_Man_Dehyd | 291 | 466 | 9.8e-19 | 68.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.