LXL04_010797 | RubberDandelionOmics

Gene overview

LXL04_010797

Reference: OH-1004 Chr: Chr02 Coordinates: 153646307-153654380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6915 bp · LXL04_010797|LXL04_010797|OH1004|cDNA

ATGCAGGTGCCAACTAAGGACACCGGAAATGCCACCTCCTCCACCGCCGCCACCGAAGTGAGCACCAACTCAGATGCCGCCCTCGATCCAACACCCCTCGACTTCCCCTTCCAACTGATCAAATCGGAAACTATCCCTCCTGCTCCGACCCGAACCGAATCCGCCATCGATTGGTTACCGGACTACCTAGGTCACGCATGGATTGCCTACGCCGCCTCGTCCCTTCTCGTGATCTCTCACTTCCCATCTCCGTCTGACAA...

CDS

Download CDS FASTA

6915 bp · LXL04_010797|LXL04_010797|OH1004|CDS

ATGCAGGTGCCAACTAAGGACACCGGAAATGCCACCTCCTCCACCGCCGCCACCGAAGTGAGCACCAACTCAGATGCCGCCCTCGATCCAACACCCCTCGACTTCCCCTTCCAACTGATCAAATCGGAAACTATCCCTCCTGCTCCGACCCGAACCGAATCCGCCATCGATTGGTTACCGGACTACCTAGGTCACGCATGGATTGCCTACGCCGCCTCGTCCCTTCTCGTGATCTCTCACTTCCCATCTCCGTCTGACAA...

Protein

Download Protein FASTA

2304 aa · LXL04_010797|LXL04_010797|OH1004|PROTEIN

MQVPTKDTGNATSSTAATEVSTNSDAALDPTPLDFPFQLIKSETIPPAPTRTESAIDWLPDYLGHAWIAYAASSLLVISHFPSPSDNNETPVDPFFRQVIELSTHGSGDVSSVSWSPSVKSSGEVAAALDNCVAVFSHNLEDQNITNNTDSYSGSFCWSQTAILQQARNSNSIKWTGSGDGLISVGIDIILWKKNNLSWEISWKFTPEVPQTLISATSSIEGPFATSPLNKHTNNNTNTCVLIGQGKSKCIKSELHHHTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010797`
TK1151 ID	TkA03G549450
OH-1004 ID	LXL04_010797
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.500
Protein coverage (%)	TK1151 97.818 / OH-1004 23.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_010797`
Location	Chr02:153646307-153654380 (-)
Description	Similar to RAV1: Regulator of V-ATPase in vacuolar membrane protein 1 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010797` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0007035 vacuolar acidification Biological Process GO:0007283 spermatogenesis Biological Process GO:0015031 protein transport Biological Process GO:0032880 regulation of protein localization Biological Process GO:0042593 glucose homeostasis Biological Process GO:0043254 regulation of protein-containing complex assembly Biological Process GO:0045022 early endosome to late endosome transport Biological Process GO:0070070 proton-transporting V-type ATPase complex assembly Biological Process GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Biological Process GO:0005615 extracellular space Cellular Component GO:0005737 cytoplasm Cellular Component GO:0012505 endomembrane system Cellular Component
KEGG gene cross-reference	hsa:1657 hsa:23312 mmu:240283 sce:YJR033C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.429

Rank 1 · LXL04_010797 · OH-1004

Cytoplasm0.426

Rank 2 · LXL04_010797 · OH-1004

Golgi apparatus0.089

Rank 3 · LXL04_010797 · OH-1004

Lysosome / Vacuole0.070

Rank 4 · LXL04_010797 · OH-1004

Cell membrane0.070

Rank 5 · LXL04_010797 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12234.14Rav1p_C699-1286 aa

PF00400.39WD402198-2229 aa

PF25172.2Beta-prop_WDR3_2nd2198-2240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010797	`PF12234.14`	Rav1p_C	699	1286	9.4e-80	269.5
LXL04_010797	`PF00400.39`	WD40	2198	2229	1.9e-20	73.1
LXL04_010797	`PF25172.2`	Beta-prop_WDR3_2nd	2198	2240	1.6e-08	34.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card