LXL04_010724 | RubberDandelionOmics

Gene overview

LXL04_010724

Reference: OH-1004 Chr: Chr02 Coordinates: 152153743-152157217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_010724|LXL04_010724|OH1004|cDNA

ATGTACGGTGGCCGGAAAGATAGCTCCGGCATGCGTACACCTGAACGTGTTACTTATCCTCCTAATTCCCCGTCCCCAAGCTCCTATTCTACCAGTTCATCCAGGTCGTCAGCGAGCGACCGAGTTAAATCTGCCGCTAGATCCGTCGCCGGAGTTTTCGTAGCTTGTTTTACACCACCGGAGGAGGAGACGCAGCATAGCTCCTCGGGGTTTGGAGGTTCTGATGCGTTCAGCTCAACATCAGATGTTTCGGGAGCTTC...

CDS

Download CDS FASTA

1326 bp · LXL04_010724|LXL04_010724|OH1004|CDS

ATGTACGGTGGCCGGAAAGATAGCTCCGGCATGCGTACACCTGAACGTGTTACTTATCCTCCTAATTCCCCGTCCCCAAGCTCCTATTCTACCAGTTCATCCAGGTCGTCAGCGAGCGACCGAGTTAAATCTGCCGCTAGATCCGTCGCCGGAGTTTTCGTAGCTTGTTTTACACCACCGGAGGAGGAGACGCAGCATAGCTCCTCGGGGTTTGGAGGTTCTGATGCGTTCAGCTCAACATCAGATGTTTCGGGAGCTTC...

Protein

Download Protein FASTA

441 aa · LXL04_010724|LXL04_010724|OH1004|PROTEIN

MYGGRKDSSGMRTPERVTYPPNSPSPSSYSTSSSRSSASDRVKSAARSVAGVFVACFTPPEEETQHSSSGFGGSDAFSSTSDVSGASDSTEGKKRHRSIYTVRNDSTHSKEPGSVKFTMADINKATKNFSPALKVGQGGFGTVYKGQLQDGTLVAVKRAKKSMYDKNLGSEFQSEIQTLSKVEHLNLVKCYGYLEHEDERIVVVEYVSNGTLREHLECELISIILFPFSIKTHSNNRYLTNSGINGNALSLDSRLEIAID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010724`
TK1151 ID	TkA03G545170
OH-1004 ID	LXL04_010724
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 59.322 / OH-1004 15.873 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010724

Location Chr02:152153743-152157217 (+)

Description Similar to CRCK2: Calmodulin-binding receptor-like cytoplasmic kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00330`	Calmodulin-binding receptor-like cytoplasmic kinase 2.	No verified direct reference in this release
`At5g58940`	Calmodulin-binding receptor-like cytoplasmic kinase 1.	No verified direct reference in this release
`At2g11520`	Calmodulin-binding receptor-like cytoplasmic kinase 3.	No verified direct reference in this release
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010724 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G11520

ath:AT2G21480

ath:AT4G00330

ath:AT4G39110

ath:AT5G58940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.721

Rank 1 · LXL04_010724 · OH-1004

Cytoplasm0.211

Rank 2 · LXL04_010724 · OH-1004

Nucleus0.206

Rank 3 · LXL04_010724 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_010724 · OH-1004

Golgi apparatus0.026

Rank 5 · LXL04_010724 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr134-428 aa

PF00069.32Pkinase134-430 aa

PF03109.23ABC1136-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010724	`PF07714.24`	PK_Tyr_Ser-Thr	134	428	5.2e-48	164.3
LXL04_010724	`PF00069.32`	Pkinase	134	430	9.9e-47	160.2
LXL04_010724	`PF03109.23`	ABC1	136	303	7.7e-06	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZJ9`	Arabidopsis thaliana	Calmodulin-binding receptor-like cytoplasmic kinase 2	55.904%	Swiss-Prot	strong database homology
`Q9FIL7`	Arabidopsis thaliana	Calmodulin-binding receptor-like cytoplasmic kinase 1	49.235%	Swiss-Prot	moderate database homology
`Q9ASQ5`	Arabidopsis thaliana	Calmodulin-binding receptor-like cytoplasmic kinase 3	52.000%	Swiss-Prot	strong database homology
`Q9T020`	Arabidopsis thaliana	Probable receptor-like protein kinase At4g39110	43.218%	Swiss-Prot	moderate database homology
`Q9SJT0`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g21480	42.587%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card