LXL04_010690 | RubberDandelionOmics

Gene overview

LXL04_010690

Reference: OH-1004 Chr: Chr02 Coordinates: 151679709-151682075 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_010690|LXL04_010690|OH1004|cDNA

ATGGCCGGCGAAGTTTCTGATCATATCAATCAGAGATTCTTCGTGGCGGTCCATGTCGGCGCTGGTTACCACTCACCGATTAACGAAAAGGCTCTCCGATCTGCCATGAAAGCTGCCTGCCTCGCCGCCGCATCTGTTCTACGAACGGGCTCCGGTGGATGTGTAGATGCTGTATCAGCAGCCATTGAAACCTTGGAGAATGATCCGTGTACAAATGCTGGAAGAGGTTCAAATTTGACAGAAGATGGTCATGTGGAATG...

CDS

Download CDS FASTA

1119 bp · LXL04_010690|LXL04_010690|OH1004|CDS

ATGGCCGGCGAAGTTTCTGATCATATCAATCAGAGATTCTTCGTGGCGGTCCATGTCGGCGCTGGTTACCACTCACCGATTAACGAAAAGGCTCTCCGATCTGCCATGAAAGCTGCCTGCCTCGCCGCCGCATCTGTTCTACGAACGGGCTCCGGTGGATGTGTAGATGCTGTATCAGCAGCCATTGAAACCTTGGAGAATGATCCGTGTACAAATGCTGGAAGAGGTTCAAATTTGACAGAAGATGGTCATGTGGAATG...

Protein

Download Protein FASTA

372 aa · LXL04_010690|LXL04_010690|OH1004|PROTEIN

MAGEVSDHINQRFFVAVHVGAGYHSPINEKALRSAMKAACLAAASVLRTGSGGCVDAVSAAIETLENDPCTNAGRGSNLTEDGHVECDASVMDGKSGTFGAVGAVPGVRNPIKIAALLVKEQMLGSSLLGRLPPMFLAGEGAHAWANSKGIFVPETIEKANEWLITRKAKQQWKNYKAMLDNAKSKIPSSSPQQIDKASAEDMIMDTVGVICIDKEGNIASGASSGGIALKVSGRVGLAATYGCGCWASSTVGCCVSGAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010690`
TK1151 ID	TkA03G543770
OH-1004 ID	LXL04_010690
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 67.204 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010690

Location Chr02:151679709-151682075 (-)

Description Similar to At4g00590: Putative threonine aspartase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00590`	Putative threonine aspartase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010690 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0033345 L-asparagine catabolic process via L-aspartate Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051604 protein maturation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004067 asparaginase activity Molecular Function

GO:0004298 threonine-type endopeptidase activity Molecular Function

GO:0008798 beta-aspartyl-peptidase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT4G00590

hsa:55617

mmu:75812

rno:246307

xla:444536

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · LXL04_010690 · OH-1004

Nucleus0.430

Rank 2 · LXL04_010690 · OH-1004

Mitochondrion0.123

Rank 3 · LXL04_010690 · OH-1004

Peroxisome0.064

Rank 4 · LXL04_010690 · OH-1004

Cell membrane0.049

Rank 5 · LXL04_010690 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01112.24Asparaginase_214-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010690	`PF01112.24`	Asparaginase_2	14	311	3.1e-52	178.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65268`	Arabidopsis thaliana	Putative threonine aspartase	57.320%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card