LXL04_010394 | RubberDandelionOmics

Gene overview

LXL04_010394

Reference: OH-1004 Chr: Chr02 Coordinates: 146014615-146014998 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · LXL04_010394|LXL04_010394|OH1004|cDNA

ATGACGGAGGAGTTTCAAGAATCGGAAGTAGTCTTCCCCGAAAATTCCGCCGGAAACGGAAAAGAAGTCCGATATCCAAAAGTAGATAAAAGAAAATTCGATAAGAAAAAGCAGAAGAAGGGTTCCGGTTCGGTTCCGATGAGCATCCGGGAAGAATTTTCCGACAGTTCATGGATTCGTCAGTATTTACAAACACATTCATTTAAAGAAGATGATGcagacgaagaagaagagagagtGCCGCCGCACGTGATCTTGGA...

CDS

Download CDS FASTA

384 bp · LXL04_010394|LXL04_010394|OH1004|CDS

ATGACGGAGGAGTTTCAAGAATCGGAAGTAGTCTTCCCCGAAAATTCCGCCGGAAACGGAAAAGAAGTCCGATATCCAAAAGTAGATAAAAGAAAATTCGATAAGAAAAAGCAGAAGAAGGGTTCCGGTTCGGTTCCGATGAGCATCCGGGAAGAATTTTCCGACAGTTCATGGATTCGTCAGTATTTACAAACACATTCATTTAAAGAAGATGATGCAGACGAAGAAGAAGAGAGAGTGCCGCCGCACGTGATCTTGGA...

Protein

Download Protein FASTA

127 aa · LXL04_010394|LXL04_010394|OH1004|PROTEIN

MTEEFQESEVVFPENSAGNGKEVRYPKVDKRKFDKKKQKKGSGSVPMSIREEFSDSSWIRQYLQTHSFKEDDADEEEERVPPHVILERRIAGKAAFSLCSGNGRTLKGRDLNNVRNSILRMTGFLES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010394`
TK1151 ID	TkA03G525430
OH-1004 ID	LXL04_010394
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010394

Location Chr02:146014615-146014998 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29640`	Protein S40-1.	No verified direct reference in this release
`At5g45630`	Protein S40-2.	No verified direct reference in this release
`At4g18980`	Regulates senescence either by modulating WRKY53 or by activating SAG12.	Nuclear targeted AtS40 modulates senescence associated gene expression in Arabidopsis thaliana during natural development and in darkness.2010 · DOI: 10.1007/s11103-010-9618-3 Genome-wide association study uncovers a novel QTL allele of AtS40-3 that affects the sex ratio of cyst nematodes in Arabidopsis.2018 · DOI: 10.1093/jxb/ery019
`At3g15040`	Protein S40-7.	No verified direct reference in this release
`At2g28400`	Protein S40-4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010394 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002215 defense response to nematode Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G29640

ath:AT2G28400

ath:AT3G15040

ath:AT4G18980

ath:AT5G45630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.669

Rank 1 · LXL04_010394 · OH-1004

Cytoplasm0.352

Rank 2 · LXL04_010394 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_010394 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_010394 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_010394 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04520.19Senescence_reg28-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010394	`PF04520.19`	Senescence_reg	28	126	3.4e-25	90.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7N7`	Arabidopsis thaliana	Protein S40-1	40.845%	Swiss-Prot	moderate database homology
`Q9FK78`	Arabidopsis thaliana	Protein S40-2	39.394%	Swiss-Prot	moderate database homology
`Q8GX72`	Arabidopsis thaliana	Protein S40-3	39.062%	Swiss-Prot	moderate database homology
`Q9LKA1`	Arabidopsis thaliana	Protein S40-7	51.923%	Swiss-Prot	weak database homology
`Q9SKN0`	Arabidopsis thaliana	Protein S40-4	52.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card