LXL04_010161 | RubberDandelionOmics

Gene overview

LXL04_010161

Reference: OH-1004 Chr: Chr02 Coordinates: 141264104-141267965 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_010161|LXL04_010161|OH1004|cDNA

ATGATTTTAAGTGGGGTTGCTCCTGGAAAAGAGACGAGCACTTCCTCCCTGCAAAACCACAAGATCCATCGGTTCTCTTCTATTTCTTTCTACTCAAAACCCCTGATCCCCTTATCTTTCTTTCTTCACCCGACAGCCGATCGATCGGAGAAACCCTTCGCCGGTTCTCGTCTCACTCTCGGCATCCCTCTTCCTCGCAAAGCCGACCATCGTCTTCTCCATCGTCGACGAACCATCACGGGATCGAGAGAGAGCGACGG...

CDS

Download CDS FASTA

1086 bp · LXL04_010161|LXL04_010161|OH1004|CDS

ATGATTTTAAGTGGGGTTGCTCCTGGAAAAGAGACGAGCACTTCCTCCCTGCAAAACCACAAGATCCATCGGTTCTCTTCTATTTCTTTCTACTCAAAACCCCTGATCCCCTTATCTTTCTTTCTTCACCCGACAGCCGATCGATCGGAGAAACCCTTCGCCGGTTCTCGTCTCACTCTCGGCATCCCTCTTCCTCGCAAAGCCGACCATCGTCTTCTCCATCGTCGACGAACCATCACGGGATCGAGAGAGAGCGACGG...

Protein

Download Protein FASTA

361 aa · LXL04_010161|LXL04_010161|OH1004|PROTEIN

MILSGVAPGKETSTSSLQNHKIHRFSSISFYSKPLIPLSFFLHPTADRSEKPFAGSRLTLGIPLPRKADHRLLHRRRTITGSRESDGKGRPRPPFFFVSFTRQLQGPSNLQSEPTNQRCNRSRRAAIGADEQPPAIQCGRGFQGWWRFVGLATDFNATIGMVVMVAGNSIGIGGTSNLQSEPDDTNFANWSHQAVDFILATQKLKNRMKCFYFLVVLVLLLATSLEINAQTCKPSGGIRGKKPPRGQCNTENDSDCCVQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010161`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010161

Location Chr02:141264104-141267965 (-)

Description Similar to Os10g0490500: Putative ripening-related protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0490500`	Putative ripening-related protein 5.	No verified direct reference in this release
`Os04g0364800`	Putative ripening-related protein 1.	No verified direct reference in this release
`Os02g0637000`	Putative ripening-related protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0050832 defense response to fungus Biological Process

GO:0051851 host-mediated perturbation of symbiont process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

KEGG gene cross-reference

dosa:Os04g0364800

zma:103626138

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.281

Rank 1 · LXL04_010161 · OH-1004

Extracellular0.267

Rank 2 · LXL04_010161 · OH-1004

Nucleus0.214

Rank 3 · LXL04_010161 · OH-1004

Cell membrane0.142

Rank 4 · LXL04_010161 · OH-1004

Endoplasmic reticulum0.137

Rank 5 · LXL04_010161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24300.1KWL1229-260 aa

PF24300.1KWL1260-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010161	`PF24300.1`	KWL1	229	260	2.8e-41	142.1
LXL04_010161	`PF24300.1`	KWL1	260	360	2.8e-41	142.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LN49`	Oryza sativa subsp. japonica	Putative ripening-related protein 5	50.296%	Swiss-Prot	weak database homology
`Q7XVA8`	Oryza sativa subsp. japonica	Putative ripening-related protein 1	43.784%	Swiss-Prot	weak database homology
`Q6H5X0`	Oryza sativa subsp. japonica	Putative ripening-related protein 2	62.745%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card