LXL04_009375 | RubberDandelionOmics

Gene overview

LXL04_009375

Reference: OH-1004 Chr: Chr02 Coordinates: 124458334-124464352 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4071 bp · LXL04_009375|LXL04_009375|OH1004|cDNA

ATGAAGAAACCAAACTACAATCACGAGGAAGAAGCCGGCATCTCACCACTCACATCCAAATCAGCTGCCTTTTTGTTCCTAGCTGGAGAGATGGCCTGCATGTTAAATTCCGATCCAAGGCGTTTGTATTCTTGGTGGTGGGACAGCCATATTAGCCCTAAAAATTCAAAATGGCTTCAAGAGAATCTTACAGATATGGATACGAAAGTGAAGTCCATGATCAAATTGATTGAAGAAGACGCAGATTCATTTGCAAGGAG...

CDS

Download CDS FASTA

4071 bp · LXL04_009375|LXL04_009375|OH1004|CDS

ATGAAGAAACCAAACTACAATCACGAGGAAGAAGCCGGCATCTCACCACTCACATCCAAATCAGCTGCCTTTTTGTTCCTAGCTGGAGAGATGGCCTGCATGTTAAATTCCGATCCAAGGCGTTTGTATTCTTGGTGGTGGGACAGCCATATTAGCCCTAAAAATTCAAAATGGCTTCAAGAGAATCTTACAGATATGGATACGAAAGTGAAGTCCATGATCAAATTGATTGAAGAAGACGCAGATTCATTTGCAAGGAG...

Protein

Download Protein FASTA

1356 aa · LXL04_009375|LXL04_009375|OH1004|PROTEIN

MKKPNYNHEEEAGISPLTSKSAAFLFLAGEMACMLNSDPRRLYSWWWDSHISPKNSKWLQENLTDMDTKVKSMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDYATGELRHAQKTLQAAFPDQVHFTLPEDSSSSSSIPDDQTTESFIKIFEIGKLNKALTDLTTEKESLLAQYRESLERICSVDEELNRAVEKAKVLDGIAIEAEKEVHLLKESLRVLQVEKDAGLAKQMEYLDTISDLEEKIEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009375`
TK1151 ID	TkA03G430470
OH-1004 ID	LXL04_009375
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 97.788 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009375

Location Chr02:124458334-124464352 (-)

Description Similar to NET1A: Protein NETWORKED 1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22790`	Plant-specific actin binding protein.	A superfamily of actin-binding proteins at the actin-membrane nexus of higher plants.2012 · DOI: 10.1016/j.cub.2012.06.041
`At4g14760`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g03080`	Plant-specific actin binding protein.	No verified direct reference in this release
`At4g02710`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G03080

ath:AT3G22790

ath:AT4G14760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.484

Rank 1 · LXL04_009375 · OH-1004

Nucleus0.259

Rank 2 · LXL04_009375 · OH-1004

Cell membrane0.241

Rank 3 · LXL04_009375 · OH-1004

Golgi apparatus0.083

Rank 4 · LXL04_009375 · OH-1004

Endoplasmic reticulum0.076

Rank 5 · LXL04_009375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07765.18KIP144-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009375	`PF07765.18`	KIP1	44	117	2.1e-38	131.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUI2`	Arabidopsis thaliana	Protein NETWORKED 1A	38.889%	Swiss-Prot	moderate database homology
`F4JIF4`	Arabidopsis thaliana	Protein NETWORKED 1B	38.889%	Swiss-Prot	moderate database homology
`F4HZB5`	Arabidopsis thaliana	Protein NETWORKED 1D	36.184%	Swiss-Prot	moderate database homology
`Q9ZQX8`	Arabidopsis thaliana	Protein NETWORKED 1C	34.586%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card