LXL04_009338 | RubberDandelionOmics

Gene overview

LXL04_009338

Reference: OH-1004 Chr: Chr02 Coordinates: 123524722-123526260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · LXL04_009338|LXL04_009338|OH1004|cDNA

ATGGATGATAAGTACTCAACTTGGATGCTATGTTGGAGTCAACAATCTCAGCCTTTCCTTACTATATATAGGAAGAAGAGGTTTGGTTATAATCAATTAAGGAAGATGACTGAGATCAAGATGGCTCACCTCACTCTTGCTTTTGGCCTTCTTGGCAATATTGTCTCGTTTATGGTTTTTCTCGCACCCATACCGACATTTTACAAAATTTACAAAAAGAAATCAACAGAAGGGTTTCAATCAGCGCCTTATGTGGTGGG...

CDS

Download CDS FASTA

966 bp · LXL04_009338|LXL04_009338|OH1004|CDS

ATGGATGATAAGTACTCAACTTGGATGCTATGTTGGAGTCAACAATCTCAGCCTTTCCTTACTATATATAGGAAGAAGAGGTTTGGTTATAATCAATTAAGGAAGATGACTGAGATCAAGATGGCTCACCTCACTCTTGCTTTTGGCCTTCTTGGCAATATTGTCTCGTTTATGGTTTTTCTCGCACCCATACCGACATTTTACAAAATTTACAAAAAGAAATCAACAGAAGGGTTTCAATCAGCGCCTTATGTGGTGGG...

Protein

Download Protein FASTA

321 aa · LXL04_009338|LXL04_009338|OH1004|PROTEIN

MDDKYSTWMLCWSQQSQPFLTIYRKKRFGYNQLRKMTEIKMAHLTLAFGLLGNIVSFMVFLAPIPTFYKIYKKKSTEGFQSAPYVVGLFSAMLWIYYAFLKTNVMLLITINSVGCIIETLYICFFLFYAPKKVRMESLKLIILLVIVGFGLIVVSTQFLATGVNRGVIVGWICLVFSLCVFVAPLGVLRQVIKTKSVEYMPILLSVALTLSAVMWFFYGLLLGDFNIAIPNVLGFTFGIIQMILYFAYKNNKLITNEKVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009338`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009338

Location Chr02:123524722-123526260 (+)

Description Similar to SWEET14: Bidirectional sugar transporter SWEET14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50790`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BKP4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os11g0508600`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606 Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
`Os12g0476200`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009338 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0009555 pollen development Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0015770 sucrose transport Biological Process

GO:0048571 long-day photoperiodism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008515 sucrose transmembrane transporter activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G50790

dosa:Os11g0508600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.605

Rank 1 · LXL04_009338 · OH-1004

Endoplasmic reticulum0.166

Rank 2 · LXL04_009338 · OH-1004

Lysosome / Vacuole0.147

Rank 3 · LXL04_009338 · OH-1004

Cytoplasm0.101

Rank 4 · LXL04_009338 · OH-1004

Golgi apparatus0.078

Rank 5 · LXL04_009338 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv48-132 aa

PF03083.22MtN3_slv168-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009338	`PF03083.22`	MtN3_slv	48	132	2.1e-54	182.2
LXL04_009338	`PF03083.22`	MtN3_slv	168	252	2.1e-54	182.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUE3`	Arabidopsis thaliana	Bidirectional sugar transporter SWEET10	50.741%	Swiss-Prot	strong database homology
`B8BKP4`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET14	52.593%	Swiss-Prot	strong database homology
`Q2R3P9`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET14	52.593%	Swiss-Prot	strong database homology
`Q2QR07`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET13	50.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card