LXL04_009145 | RubberDandelionOmics

Gene overview

LXL04_009145

Reference: OH-1004 Chr: Chr02 Coordinates: 118570348-118574974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1872 bp · LXL04_009145|LXL04_009145|OH1004|cDNA

ATGCCGTCTGCGTATGGAGCTCGGTTGACCACTTTCGAAGATTCTGAGAAGGAGAGCGAGTGTGGATACGTCCGCAAGGTGTCAGGACCTGTTGTCATTGCAGATGGAATGGCAGGAGCTGCTATGTATGAACTTGTTCGTGTTGGCCATGACAACCTCATTGGAGAGATTATTCGTTTGGAAGGAGATTCAGCCACAATCCAAGTTTATGAAGAGACAGCTGGATTAATGGTGAATGATCCTGTTTTACGGACACACAA...

CDS

Download CDS FASTA

1872 bp · LXL04_009145|LXL04_009145|OH1004|CDS

ATGCCGTCTGCGTATGGAGCTCGGTTGACCACTTTCGAAGATTCTGAGAAGGAGAGCGAGTGTGGATACGTCCGCAAGGTGTCAGGACCTGTTGTCATTGCAGATGGAATGGCAGGAGCTGCTATGTATGAACTTGTTCGTGTTGGCCATGACAACCTCATTGGAGAGATTATTCGTTTGGAAGGAGATTCAGCCACAATCCAAGTTTATGAAGAGACAGCTGGATTAATGGTGAATGATCCTGTTTTACGGACACACAA...

Protein

Download Protein FASTA

623 aa · LXL04_009145|LXL04_009145|OH1004|PROTEIN

MPSAYGARLTTFEDSEKESECGYVRKVSGPVVIADGMAGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAKRSGDVYIPRGVSVPALDKDILWEFQPKKIGVGDLVTGGDLYATVFENSLVEHRIALPPDAMGKVVSIAAPGQYSLQDTVLELEFQGVTKKFTMLQTWPVRTPRPVASKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009145`
TK1151 ID	TkA03G401100
OH-1004 ID	LXL04_009145
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009145`
Location	Chr02:118570348-118574974 (-)
Description	Similar to V-type proton ATPase catalytic subunit A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009145` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0046034 ATP metabolic process Biological Process GO:0090377 seed trichome initiation Biological Process GO:0090378 seed trichome elongation Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0033180 proton-transporting V-type ATPase, V1 domain Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function
KEGG gene cross-reference	ghi:107930394 vra:106773955 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · LXL04_009145 · OH-1004

Nucleus0.173

Rank 2 · LXL04_009145 · OH-1004

Cell membrane0.116

Rank 3 · LXL04_009145 · OH-1004

Lysosome / Vacuole0.094

Rank 4 · LXL04_009145 · OH-1004

Endoplasmic reticulum0.085

Rank 5 · LXL04_009145 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02874.30ATP-synt_ab_N25-85 aa

PF16886.12ATP-synt_ab_Xtn127-214 aa

PF00006.32ATP-synt_ab232-458 aa

PF22919.2ATP-synt_VA_C465-561 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009145	`PF02874.30`	ATP-synt_ab_N	25	85	7.5e-16	59.1
LXL04_009145	`PF16886.12`	ATP-synt_ab_Xtn	127	214	2.9e-28	98.2
LXL04_009145	`PF00006.32`	ATP-synt_ab	232	458	1.1e-74	251.4
LXL04_009145	`PF22919.2`	ATP-synt_VA_C	465	561	2.3e-29	102.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card