Gene Card
Gene overview
cDNA / CDS / Protein Sequences
792 bp · LXL04_008601|LXL04_008601|OH1004|cDNA
atgggtttgacattatcagattataaggttcgaccttacaatatTGAAGAACAGCGCACGCAATATCCCGATCGGAAGAACAGCGCACGCCATTGCCGCATAGCGGCCAATCTCCACTTCAAATTGGTTTCGATTTTGCCAAGAAGCATTTTGTATGCTGTTGACCTGGTTGACCTGGCGGTTGAACCGGTTGACCCGATTGACCCGGGAATCGGTGGCAGTGACGGGTTGATCAAAAaaccgggttttaaaacattggt...
792 bp · LXL04_008601|LXL04_008601|OH1004|CDS
ATGGGTTTGACATTATCAGATTATAAGGTTCGACCTTACAATATTGAAGAACAGCGCACGCAATATCCCGATCGGAAGAACAGCGCACGCCATTGCCGCATAGCGGCCAATCTCCACTTCAAATTGGTTTCGATTTTGCCAAGAAGCATTTTGTATGCTGTTGACCTGGTTGACCTGGCGGTTGAACCGGTTGACCCGATTGACCCGGGAATCGGTGGCAGTGACGGGTTGATCAAAAAACCGGGTTTTAAAACATTGGT...
Protein
Download Protein FASTA263 aa · LXL04_008601|LXL04_008601|OH1004|PROTEIN
MGLTLSDYKVRPYNIEEQRTQYPDRKNSARHCRIAANLHFKLVSILPRSILYAVDLVDLAVEPVDPIDPGIGGSDGLIKKPGFKTLVEIEFLEEQIVNHEKVVDLAAFDLHWRPPLATSDPFELGSDDDDEQGGNEDDDIRAVFFLGVATDSKVQSAVPFEIGSDDDDEQGSSEVAAVDSPVKTTTTSRAAKKTTAIPSAPVLRAFYAKAVNLLLAFHRTLLPHMLPSEVAFAAAVSALGIENKDGVVIYDGKGIFSAAR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008601 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008601 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:103841142-103843465 (+) | |||||||||
| Description | Similar to STR1: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002143 tRNA wobble position uridine thiolation Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0042262 DNA protection Biological Process GO:0046677 response to antibiotic Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0004792 thiosulfate-cyanide sulfurtransferase activity Molecular Function GO:0016783 sulfurtransferase activity Molecular Function GO:0016784 3-mercaptopyruvate sulfurtransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G16460 ath:AT1G79230 ece:Z3788 ecj:JW2505 eco:b2521 ecoc:C3026_13975 ecs:ECs_3387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.