LXL04_008179 | RubberDandelionOmics

Gene overview

LXL04_008179

Reference: OH-1004 Chr: Chr02 Coordinates: 91363114-91364864 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_008179|LXL04_008179|OH1004|cDNA

ATGGGAATTGGAAAAGATGGGAAACTACCATGGCGGTTACCTTCTGACCTCAAGTTTTTTAAAGATGTCACCATGACAACATCAAATCCAGTGAAAAAGAACGCAATCATAATGGGAAGGAAAACATGGGAAAGCATACCACTTGAACATAGGCCCCTCATTGGTCGCCTTAATGTTGTTTTAACTCGTTCATGGAGTTTTGATATTGCAACTGCTGAAAATGTTTTGATGTGGTGGCGAAATCTTAAGAAATTGAAGAG...

CDS

Download CDS FASTA

648 bp · LXL04_008179|LXL04_008179|OH1004|CDS

ATGGGAATTGGAAAAGATGGGAAACTACCATGGCGGTTACCTTCTGACCTCAAGTTTTTTAAAGATGTCACCATGACAACATCAAATCCAGTGAAAAAGAACGCAATCATAATGGGAAGGAAAACATGGGAAAGCATACCACTTGAACATAGGCCCCTCATTGGTCGCCTTAATGTTGTTTTAACTCGTTCATGGAGTTTTGATATTGCAACTGCTGAAAATGTTTTGATGTGGTGGCGAAATCTTAAGAAATTGAAGAG...

Protein

Download Protein FASTA

215 aa · LXL04_008179|LXL04_008179|OH1004|PROTEIN

MGIGKDGKLPWRLPSDLKFFKDVTMTTSNPVKKNAIIMGRKTWESIPLEHRPLIGRLNVVLTRSWSFDIATAENVLMWWRNLKKLKSALGLPLRFGWNGDPCVPQQHPWSGVDCQFDSAKIKWFIDGLGLDNQGLRGYLPDDISKLNHLQHMNLSGNSIQGVIPSSLGKIASLEVLDLSYNMFNGSIPESLGGQNAGKMRGNAFTAFGALSHYGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008179`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008179

Location Chr02:91363114-91364864 (+)

Description Similar to RLP4: Receptor-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28340`	Receptor-like protein 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0446900`	Bifunctional enzyme.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008179 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006231 dTMP biosynthetic process Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0032259 methylation Biological Process

GO:0042545 cell wall modification Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G28340

gmx:547833

zma:541707

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.324

Rank 1 · LXL04_008179 · OH-1004

Extracellular0.155

Rank 2 · LXL04_008179 · OH-1004

Endoplasmic reticulum0.136

Rank 3 · LXL04_008179 · OH-1004

Plastid0.116

Rank 4 · LXL04_008179 · OH-1004

Cytoplasm0.111

Rank 5 · LXL04_008179 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00186.25DHFR_13-73 aa

PF13855.13LRR_8130-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008179	`PF00186.25`	DHFR_1	3	73	3.5e-18	66.5
LXL04_008179	`PF13855.13`	LRR_8	130	182	6.7e-08	32.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HWL3`	Arabidopsis thaliana	Receptor-like protein 4	51.955%	Swiss-Prot	strong database homology
`Q2QRX6`	Oryza sativa subsp. japonica	Putative bifunctional dihydrofolate reductase-thymidylate synthase	71.429%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card