LXL04_008130 | RubberDandelionOmics

Gene overview

LXL04_008130

Reference: OH-1004 Chr: Chr02 Coordinates: 88081151-88082881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

883 bp · LXL04_008130|LXL04_008130|OH1004|cDNA

ATGGTGACAGAAGGAGGAAGGACGACCGGGAAGCTTTATGAGTGTTTAACCCTAGTTTTCTATTCGGTATTGTATAATGATTTCGTACCACCACGAAACCACCATGGTTCACCACCATCAGACCACCGTCATCCTTCATTGAATTTTTTTGCTAAAAAATCCGTGTTAATGAGTACATCTCCAGACATCTctataaagATGTGGATCTTTGATACAACAGATGGTGATACTCGATTGTTAAAGTTCAGAAGTGGTCATAG...

CDS

Download CDS FASTA

792 bp · LXL04_008130|LXL04_008130|OH1004|CDS

ATGGTGACAGAAGGAGGAAGGACGACCGGGAAGCTTTATGAGTGTTTAACCCTAGTTTTCTATTCGGTATTGTATAATGATTTCGTACCACCACGAAACCACCATGGTTCACCACCATCAGACCACCGTCATCCTTCATTGAATTTTTTTGCTAAAAAATCCGTGTTAATGAGTACATCTCCAGACATCTCTATAAAGATGTGGATCTTTGATACAACAGATGGTGATACTCGATTGTTAAAGTTCAGAAGTGGTCATAG...

Protein

Download Protein FASTA

263 aa · LXL04_008130|LXL04_008130|OH1004|PROTEIN

MVTEGGRTTGKLYECLTLVFYSVLYNDFVPPRNHHGSPPSDHRHPSLNFFAKKSVLMSTSPDISIKMWIFDTTDGDTRLLKFRSGHSAPPRLVQQMIFECHMFYANGRHVLSAGQDRVHSVSSLLFRYNTLDQEEIKLKPVIAFDVVILLAEIRERDWSNVVTCQIDTLHTYVSSLQNVFPGEHILTPSTDIQTPIKACTISSYGNFAVLETSGGWIEKFNLQSGVSRGCYVVMSESRRCGHDGEVVDVACDSTNSLKEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008130`
TK1151 ID	TkA01G489080
OH-1004 ID	LXL04_008130
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.500
Protein coverage (%)	TK1151 35.784 / OH-1004 31.179 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_008130`
Location	Chr02:88081151-88082881 (+)
Description	Similar to WDR36: WD repeat-containing protein 36
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008130` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0030686 90S preribosome Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0032153 cell division site Cellular Component GO:0034388 Pwp2p-containing subcomplex of 90S preribosome Cellular Component GO:0072686 mitotic spindle Cellular Component
KEGG gene cross-reference	hsa:134430 sce:YLR409C spo:2539299 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.475

Rank 1 · LXL04_008130 · OH-1004

Cytoplasm0.384

Rank 2 · LXL04_008130 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_008130 · OH-1004

Mitochondrion0.075

Rank 4 · LXL04_008130 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_008130 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25168.2Beta-prop_WDR36-Utp21_2nd131-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008130	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	131	256	4.9e-22	79.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card