LXL04_007770 | RubberDandelionOmics

Gene overview

LXL04_007770

Reference: OH-1004 Chr: Chr02 Coordinates: 60294106-60299707 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2805 bp · LXL04_007770|LXL04_007770|OH1004|cDNA

ATGGGGGAAGAAGAAACTAGGGATGAACTTCCCTCCAATGAGAAAGAATTGGCCTCTGATTCTACTGCAACAACAGAGGATAAAAACACAATTCAAGCAGAAGATAGTaatgctgaagaagaagaagaagatgatgatggtgatgatgatgaagaagaagaagaagatgcaGAAGAGCCTTTTACATTAAGATTTGAAGGAGAGACAAATCCCTTGGCTCTCACAGAAGTGGATGCATTTGGAGCTCAGCCTTATGAGCA...

CDS

Download CDS FASTA

2805 bp · LXL04_007770|LXL04_007770|OH1004|CDS

ATGGGGGAAGAAGAAACTAGGGATGAACTTCCCTCCAATGAGAAAGAATTGGCCTCTGATTCTACTGCAACAACAGAGGATAAAAACACAATTCAAGCAGAAGATAGTAATGCTGAAGAAGAAGAAGAAGATGATGATGGTGATGATGATGAAGAAGAAGAAGAAGATGCAGAAGAGCCTTTTACATTAAGATTTGAAGGAGAGACAAATCCCTTGGCTCTCACAGAAGTGGATGCATTTGGAGCTCAGCCTTATGAGCA...

Protein

Download Protein FASTA

934 aa · LXL04_007770|LXL04_007770|OH1004|PROTEIN

MGEEETRDELPSNEKELASDSTATTEDKNTIQAEDSNAEEEEEDDDGDDDEEEEEDAEEPFTLRFEGETNPLALTEVDAFGAQPYEQLERLENEYEALAAKKRKANNHQGMPPGKKLRQDDFPGANFEELLAEMTYGMRRKRKIKKRGRRKGSKRKLSPEITQKLGDATLHYAHGDYEKAIPLLKEIILSSPNLPDPYHTLGLIYNATGKKKKAIDFYMLAVHLTPKDASLWKLLVTWSLEQGNHGQARYCLDRAIRADP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007770`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007770

Location Chr02:60294106-60299707 (+)

Description Similar to GTF3C3: General transcription factor 3C polypeptide 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18420`	Required for the early stage of chloroplast development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007770 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006383 transcription by RNA polymerase III Biological Process

GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process

GO:0042791 5S class rRNA transcription by RNA polymerase III Biological Process

GO:0042797 tRNA transcription by RNA polymerase III Biological Process

GO:0000127 transcription factor TFIIIC complex Cellular Component

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0000995 RNA polymerase III general transcription initiation factor activity Molecular Function

KEGG gene cross-reference

hsa:9330

sce:YGR047C

spo:2539187

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.520

Rank 1 · LXL04_007770 · OH-1004

Cytoplasm0.405

Rank 2 · LXL04_007770 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_007770 · OH-1004

Golgi apparatus0.058

Rank 4 · LXL04_007770 · OH-1004

Cell membrane0.050

Rank 5 · LXL04_007770 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29407.1CFAP70_TPR_C160-366 aa

PF14559.13TPR_19172-235 aa

PF23914.2TPR_CcmH_CycH223-316 aa

PF13371.13TPR_9238-305 aa

PF13432.13TPR_16240-294 aa

PF14559.13TPR_19275-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007770	`PF29407.1`	CFAP70_TPR_C	160	366	1e-13	52.1
LXL04_007770	`PF14559.13`	TPR_19	172	235	1.3e-22	80.6
LXL04_007770	`PF23914.2`	TPR_CcmH_CycH	223	316	6.2e-09	36.6
LXL04_007770	`PF13371.13`	TPR_9	238	305	4.3e-16	59.4
LXL04_007770	`PF13432.13`	TPR_16	240	294	4.4e-12	46.9
LXL04_007770	`PF14559.13`	TPR_19	275	332	1.3e-22	80.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS48`	Arabidopsis thaliana	protein SLOW GREEN 1, chloroplastic	28.758%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card