Gene Card
Gene overview
cDNA / CDS / Protein Sequences
894 bp · LXL04_007136|LXL04_007136|OH1004|cDNA
ATGTCTGTTGCTTCTACTTCTTCAAGTAGCAATTGGGTTAATACTCGATCGAAATTCTCTTCCTCACCTAGAAGCCGATTGTGTTCGTCCTCCATCTCTTACGCTAAGAAGATCAATTCTAAAAGCATTCATTGCGCAATTGAAGCAGATTCGGTCATCCGTATTCCCAATCGGTCTCCATGTAAAGAATCCACAACCACATGTCAGCCTGAAtcaccttcttcttcatcttctccagCCGCACCAAGTAATTGGAACTT...
894 bp · LXL04_007136|LXL04_007136|OH1004|CDS
ATGTCTGTTGCTTCTACTTCTTCAAGTAGCAATTGGGTTAATACTCGATCGAAATTCTCTTCCTCACCTAGAAGCCGATTGTGTTCGTCCTCCATCTCTTACGCTAAGAAGATCAATTCTAAAAGCATTCATTGCGCAATTGAAGCAGATTCGGTCATCCGTATTCCCAATCGGTCTCCATGTAAAGAATCCACAACCACATGTCAGCCTGAATCACCTTCTTCTTCATCTTCTCCAGCCGCACCAAGTAATTGGAACTT...
Protein
Download Protein FASTA297 aa · LXL04_007136|LXL04_007136|OH1004|PROTEIN
MSVASTSSSSNWVNTRSKFSSSPRSRLCSSSISYAKKINSKSIHCAIEADSVIRIPNRSPCKESTTTCQPESPSSSSSPAAPSNWNLFQKVAAMALDAIEHGLETREKKHPLPKTVDPDVQIAGNFSPVPEHPVRHSLTVTIKIDYDVLMGTPTVQALKSVARDGRTVISSIHQRSSKVFALFDDLFFAESGFPCPTKRNPSDHFLRLEVMDLKTCSAEVKVLPAMNKINGLVLLLALAEGEEGEEEIDSQLAGLVHVKN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007136 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007136 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:37094195-37095871 (-) | |||||||||
| Description | Similar to NCED1: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006869 lipid transport Biological Process GO:0009414 response to water deprivation Biological Process GO:0009555 pollen development Biological Process GO:0009651 response to salt stress Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009733 response to auxin Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009739 response to gibberellin Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009835 fruit ripening Biological Process GO:0009856 pollination Biological Process | |||||||||
| KEGG gene cross-reference | ag:AAF26356 ath:AT1G51500 ath:AT3G21090 sly:100316877 sly:544163 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.