LXL04_007130 | RubberDandelionOmics

Gene overview

LXL04_007130

Reference: OH-1004 Chr: Chr02 Coordinates: 36948586-36953320 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · LXL04_007130|LXL04_007130|OH1004|cDNA

atgagaggctgtgatgttctagatgagtttgagaTTGGATtgtgtgctcgtaagcgtgtgtgtgtaattacaagtgttatctatttatatggtCTTCAGAATAcagccgttccgtgttattcgggatcctccgagtgcaGCTTAAGctttaaccacttctccgatattcttgggatcctccgaggacttgggtcttcaacggttgttagcggcttagttccggattttatgccTCACTCGATCACCAGCGTCTACTACCT...

CDS

Download CDS FASTA

1389 bp · LXL04_007130|LXL04_007130|OH1004|CDS

ATGAGAGGCTGTGATGTTCTAGATGAGTTTGAGATTGGATTGTGTGCTCGTAAGCGTGTGTGTGTAATTACAAGTGTTATCTATTTATATGGTCTTCAGAATACAGCCGTTCCGTGTTATTCGGGATCCTCCGAGTGCAGCTTAAGCTTTAACCACTTCTCCGATATTCTTGGGATCCTCCGAGGACTTGGGTCTTCAACGGTTGTTAGCGGCTTAGTTCCGGATTTTATGCCTCACTCGATCACCAGCGTCTACTACCT...

Protein

Download Protein FASTA

462 aa · LXL04_007130|LXL04_007130|OH1004|PROTEIN

MRGCDVLDEFEIGLCARKRVCVITSVIYLYGLQNTAVPCYSGSSECSLSFNHFSDILGILRGLGSSTVVSGLVPDFMPHSITSVYYLFHSQTPLSHSSPTQRHNLPELAHTLSSIPVSYAFPTFPPTPLYLRWVCNGFVNLQPTFSTPLAKPPPPSVVELEPISSVVSLARSVIHHHCHLVSLARSVIHHHCHRLSLPLLQSTLLHHFMHHRSRVERTRSQQHSAKRSSGNRKPVRLLKSCMSRSSKYTYVTKIVRLLDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007130`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007130

Location Chr02:36948586-36953320 (-)

Description Similar to SFH12: Phosphatidylinositol/phosphatidylcholine transfer protein SFH12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36490`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At2g18180`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release
`At2g21540`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At1g75370`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007130 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0009908 flower development Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008526 phosphatidylinositol transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G75370

ath:AT2G18180

ath:AT2G21540

ath:AT4G36490

ath:AT4G39180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.413

Rank 1 · LXL04_007130 · OH-1004

Cytoplasm0.405

Rank 2 · LXL04_007130 · OH-1004

Mitochondrion0.143

Rank 3 · LXL04_007130 · OH-1004

Cell membrane0.089

Rank 4 · LXL04_007130 · OH-1004

Endoplasmic reticulum0.079

Rank 5 · LXL04_007130 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A34`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH12	58.763%	Swiss-Prot	weak database homology
`Q9SI13`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH10	58.763%	Swiss-Prot	weak database homology
`F4JVA9`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	61.446%	Swiss-Prot	weak database homology
`Q93ZE9`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH3	59.551%	Swiss-Prot	weak database homology
`Q8GXC6`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH5	57.143%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card