LXL04_006486 | RubberDandelionOmics

Gene overview

LXL04_006486

Reference: OH-1004 Chr: Chr02 Coordinates: 12094234-12097397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · LXL04_006486|LXL04_006486|OH1004|cDNA

ATGGGGAGCGTTGAGGAGACGAGAACAGGGGAAGAAGAGAAGCAGCAGATGAATAAGGCGCAGCCGCCGCTTGATCTCAATGATTTCGCCATTATCAAAGAAGGAGAAGCTGAGATTTTAATGCACGCAAAAAACGAAGTATTCTACAATAAAACGCAGGTTAACAACAGAGATTTGTCAATAGCTGTACTGAGGGCATTCATTACAAAACGCAAACAAGAACACGAAGCACAATTGTGTAAAAGATCAAAGAAATCATC...

CDS

Download CDS FASTA

1770 bp · LXL04_006486|LXL04_006486|OH1004|CDS

ATGGGGAGCGTTGAGGAGACGAGAACAGGGGAAGAAGAGAAGCAGCAGATGAATAAGGCGCAGCCGCCGCTTGATCTCAATGATTTCGCCATTATCAAAGAAGGAGAAGCTGAGATTTTAATGCACGCAAAAAACGAAGTATTCTACAATAAAACGCAGGTTAACAACAGAGATTTGTCAATAGCTGTACTGAGGGCATTCATTACAAAACGCAAACAAGAACACGAAGCACAATTGTGTAAAAGATCAAAGAAATCATC...

Protein

Download Protein FASTA

589 aa · LXL04_006486|LXL04_006486|OH1004|PROTEIN

MGSVEETRTGEEEKQQMNKAQPPLDLNDFAIIKEGEAEILMHAKNEVFYNKTQVNNRDLSIAVLRAFITKRKQEHEAQLCKRSKKSSKVSENHASESETSIKLNGSSNGESEPSEKTPDTESKTELDKPQSELKPPRVLEALSASGLRAIRYAREIEGIGQVVALDNDKASVEACRRNIKFNGSVASAKVESNLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAVQSISDGGLLMCTATDMAVLCGGNGEVCYSKYGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006486`
TK1151 ID	TkA03G041110
OH-1004 ID	LXL04_006486
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006486

Location Chr02:12094234-12097397 (+)

Description Similar to At5g15810: Probable tRNA (guanine(26)-N(2))-dimethyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15810`	Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.	No verified direct reference in this release
`At3g02320`	Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006486 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002940 tRNA N2-guanine methylation Biological Process

GO:0006400 tRNA modification Biological Process

GO:0008033 tRNA processing Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016423 tRNA (guanine) methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02320

ath:AT5G15810

dme:Dmel_CG6388

hsa:55621

mmu:212528

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.826

Rank 1 · LXL04_006486 · OH-1004

Cytoplasm0.196

Rank 2 · LXL04_006486 · OH-1004

Mitochondrion0.121

Rank 3 · LXL04_006486 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_006486 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_006486 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02005.23TRM33-480 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006486	`PF02005.23`	TRM	33	480	1.9e-117	393.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFU5`	Arabidopsis thaliana	tRNA (guanine(26)-N(2))-dimethyltransferase 1	77.818%	Swiss-Prot	strong database homology
`Q9SRU7`	Arabidopsis thaliana	tRNA (guanine(26)-N(2))-dimethyltransferase 2	78.142%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card