LXL04_006320 | RubberDandelionOmics

Gene overview

LXL04_006320

Reference: OH-1004 Chr: Chr02 Coordinates: 6801259-6801789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · LXL04_006320|LXL04_006320|OH1004|cDNA

ATGACTTCCACTAGGTGTGCAGTTTGTAAGTATTTCAGAAGAAGATGTCCTTCCGATTGCATTTTCTCACCTTATTTCCCTCCAAACAACCCTCAAAGATTCACTTGTGTTCATAGAATCTATGGTGCTAGCAACGTTGGGAAGATGCTTGAGGAATTACCCGTGGAAGATCGAGCAATTGCGGTTGAGACGTTGTATTATGAAGCTAAGTGTAGAATACAAGATCCTGTGTACGGGTGTGTAGGATTAATACCATGGTT...

CDS

Download CDS FASTA

441 bp · LXL04_006320|LXL04_006320|OH1004|CDS

ATGACTTCCACTAGGTGTGCAGTTTGTAAGTATTTCAGAAGAAGATGTCCTTCCGATTGCATTTTCTCACCTTATTTCCCTCCAAACAACCCTCAAAGATTCACTTGTGTTCATAGAATCTATGGTGCTAGCAACGTTGGGAAGATGCTTGAGGAATTACCCGTGGAAGATCGAGCAATTGCGGTTGAGACGTTGTATTATGAAGCTAAGTGTAGAATACAAGATCCTGTGTACGGGTGTGTAGGATTAATACCATGGTT...

Protein

Download Protein FASTA

146 aa · LXL04_006320|LXL04_006320|OH1004|PROTEIN

MTSTRCAVCKYFRRRCPSDCIFSPYFPPNNPQRFTCVHRIYGASNVGKMLEELPVEDRAIAVETLYYEAKCRIQDPVYGCVGLIPWLQQQLNIAQVQLAKTRAEIAFLYANVAETVAEPILGSTESLFQQNDVVDHGLDERNSWFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006320`
TK1151 ID	TkA03G026600
OH-1004 ID	LXL04_006320
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006320

Location Chr02:6801259-6801789 (+)

Description Similar to LBD24: LOB domain-containing protein 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26660`	LOB domain-containing protein 24.	No verified direct reference in this release
`At3g26620`	LOB domain-containing protein 23.	No verified direct reference in this release
`At2g30130`	LOB domain-containing protein 12.	No verified direct reference in this release
`At2g23660`	LOB domain-containing protein 10.	No verified direct reference in this release
`At1g31320`	LOB domain-containing protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006320 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0048364 root development Biological Process

GO:0080117 secondary growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G31320

ath:AT2G23660

ath:AT2G30130

ath:AT3G26620

ath:AT3G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_006320 · OH-1004

Cytoplasm0.150

Rank 2 · LXL04_006320 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_006320 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_006320 · OH-1004

Plastid0.011

Rank 5 · LXL04_006320 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195.20LOB5-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006320	`PF03195.20`	LOB	5	102	2.7e-38	131.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59468`	Arabidopsis thaliana	LOB domain-containing protein 24	62.609%	Swiss-Prot	strong database homology
`P59467`	Arabidopsis thaliana	LOB domain-containing protein 23	62.609%	Swiss-Prot	strong database homology
`Q8LBW3`	Arabidopsis thaliana	LOB domain-containing protein 12	59.223%	Swiss-Prot	strong database homology
`O64836`	Arabidopsis thaliana	LOB domain-containing protein 10	54.286%	Swiss-Prot	strong database homology
`Q9SHE9`	Arabidopsis thaliana	LOB domain-containing protein 4	56.075%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card