LXL04_006231 | RubberDandelionOmics

Gene overview

LXL04_006231

Reference: OH-1004 Chr: Chr02 Coordinates: 4501290-4502307 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

784 bp · LXL04_006231|LXL04_006231|OH1004|cDNA

ATGAAAATGTCCAAGAGTAAGATTTTGGTTGTGGGTGGTACAGGGTACATTGGCAAGAGAATTGTAAAGGCTAGTTTAGCTCAAGGCCATCCGACTTTTGTCCTTATGCGTCCAGATATCGCTCGATTGATTGAAGGTTCATTTTCCGATCATCAATCTCTCGTGGATGCCGTCAAACAAGTTGATGTTGTGATATGCACCATATCCGGGGTGCAATTGCGGTCACATAACATTCTCCTTCAACTTAAGTTTGTTGATGC...

CDS

Download CDS FASTA

738 bp · LXL04_006231|LXL04_006231|OH1004|CDS

ATGAAAATGTCCAAGAGTAAGATTTTGGTTGTGGGTGGTACAGGGTACATTGGCAAGAGAATTGTAAAGGCTAGTTTAGCTCAAGGCCATCCGACTTTTGTCCTTATGCGTCCAGATATCGCTCGATTGATTGAAGGTTCATTTTCCGATCATCAATCTCTCGTGGATGCCGTCAAACAAGTTGATGTTGTGATATGCACCATATCCGGGGTGCAATTGCGGTCACATAACATTCTCCTTCAACTTAAGTTTGTTGATGC...

Protein

Download Protein FASTA

245 aa · LXL04_006231|LXL04_006231|OH1004|PROTEIN

MKMSKSKILVVGGTGYIGKRIVKASLAQGHPTFVLMRPDIARLIEGSFSDHQSLVDAVKQVDVVICTISGVQLRSHNILLQLKFVDAIKEAGNIKRFLPSEFGIDPSRMEHALEYGKESFIDKMVVRKAIEDAKIPYTYISANCFGRYFVGNLSQLYTLVPPKDQVSIYGDGNRKVVFMDEDDVATYTVKTVDDPRTLNKTLYLRPHENILTHIQLVEKWEKLSGKPLQKVYISAQDFFASMKGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006231`
TK1151 ID	TkA03G019230
OH-1004 ID	LXL04_006231
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 47.755 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006231

Location Chr02:4501290-4502307 (-)

Description Similar to Isoflavone reductase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32100`	Reductase involved in lignan biosynthesis.	Characterization of Arabidopsis thaliana pinoresinol reductase, a new type of enzyme involved in lignan biosynthesis.2008 · DOI: 10.1074/jbc.m801131200 Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.2015 · DOI: 10.1016/j.phytochem.2014.07.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006231 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009807 lignan biosynthetic process Biological Process

GO:0019336 phenol-containing compound catabolic process Biological Process

GO:0034312 diol biosynthetic process Biological Process

GO:0042537 benzene-containing compound metabolic process Biological Process

GO:0046189 phenol-containing compound biosynthetic process Biological Process

GO:0046273 lignan catabolic process Biological Process

GO:1901502 ether catabolic process Biological Process

GO:1902123 (-)-pinoresinol catabolic process Biological Process

GO:1902125 (+)-pinoresinol catabolic process Biological Process

GO:1902128 (-)-lariciresinol catabolic process Biological Process

GO:1902129 (-)-lariciresinol biosynthetic process Biological Process

GO:1902132 (+)-lariciresinol biosynthetic process Biological Process

KEGG gene cross-reference

ag:ABM68630

ath:AT1G32100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_006231 · OH-1004

Nucleus0.178

Rank 2 · LXL04_006231 · OH-1004

Endoplasmic reticulum0.100

Rank 3 · LXL04_006231 · OH-1004

Lysosome / Vacuole0.057

Rank 4 · LXL04_006231 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_006231 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368.20NmrA5-238 aa

PF01370.28Epimerase8-97 aa

PF13460.13NAD_binding_1012-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006231	`PF05368.20`	NmrA	5	238	1.3e-54	186.5
LXL04_006231	`PF01370.28`	Epimerase	8	97	1.3e-09	38.5
LXL04_006231	`PF13460.13`	NAD_binding_10	12	143	2e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVQ6`	Arabidopsis thaliana	Pinoresinol reductase 1	61.776%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card