LXL04_006169 | RubberDandelionOmics

Gene overview

LXL04_006169

Reference: OH-1004 Chr: Chr02 Coordinates: 3009223-3013099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1989 bp · LXL04_006169|LXL04_006169|OH1004|cDNA

ATGGCACCGAGTTCTGTGGTGGTGACCATAGACAAACCGAGTAACATCTCGTTGGTTGAAGTCGACGATAATGATTCGGAAACTTCCGTGTTTCTCGAAAAGCAGAAAACAGCGAGCACGAAGCAGTTTTCATGGCTGCTTTTACTCAAAGCTCAACGAATCATCTCTTTCTTTCCATGGTTAGCAATGGGTTTTTCCAGAACTTTCACCTCTGTTAAAAAGCGCATTGCGTTATCAGATTCAAGTAAAGACGAAGTCAA...

CDS

Download CDS FASTA

1989 bp · LXL04_006169|LXL04_006169|OH1004|CDS

ATGGCACCGAGTTCTGTGGTGGTGACCATAGACAAACCGAGTAACATCTCGTTGGTTGAAGTCGACGATAATGATTCGGAAACTTCCGTGTTTCTCGAAAAGCAGAAAACAGCGAGCACGAAGCAGTTTTCATGGCTGCTTTTACTCAAAGCTCAACGAATCATCTCTTTCTTTCCATGGTTAGCAATGGGTTTTTCCAGAACTTTCACCTCTGTTAAAAAGCGCATTGCGTTATCAGATTCAAGTAAAGACGAAGTCAA...

Protein

Download Protein FASTA

662 aa · LXL04_006169|LXL04_006169|OH1004|PROTEIN

MAPSSVVVTIDKPSNISLVEVDDNDSETSVFLEKQKTASTKQFSWLLLLKAQRIISFFPWLAMGFSRTFTSVKKRIALSDSSKDEVKYKEKIMYKFIRAFLAISIVALVVEIIAYYQNWDLKLIPLEAMGLVHLSYMGWISFRAEYLAPSITMLSQFCVLLFMIQSLDRFILGIGCFWIKFKKIKPMIDDQSYDIEDPSSFPMVLVQIPMCNEREVYQQSIASACELDWPKDRILIQVLDDSSDEVLQILIRNEVNLWKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006169`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006169

Location Chr02:3009223-3013099 (+)

Description Similar to CSLC4: Xyloglucan glycosyltransferase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28180`	Beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	A gene from the cellulose synthase-like C family encodes a beta-1,4 glucan synthase.2007 · DOI: 10.1073/pnas.0703133104 Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At2g24630`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`At4g31590`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0428000`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`UniProt: Q7PC70`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006169 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048868 pollen tube development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0099402 plant organ development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G24630

ath:AT3G28180

ath:AT4G31590

dosa:Os09g0428000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.436

Rank 1 · LXL04_006169 · OH-1004

Golgi apparatus0.256

Rank 2 · LXL04_006169 · OH-1004

Cell membrane0.131

Rank 3 · LXL04_006169 · OH-1004

Nucleus0.109

Rank 4 · LXL04_006169 · OH-1004

Cytoplasm0.107

Rank 5 · LXL04_006169 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13641.13Glyco_tranf_2_3202-435 aa

PF00535.33Glycos_transf_2207-362 aa

PF13632.13Glyco_trans_2_3296-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006169	`PF13641.13`	Glyco_tranf_2_3	202	435	1.3e-12	48.7
LXL04_006169	`PF00535.33`	Glycos_transf_2	207	362	1e-10	42.5
LXL04_006169	`PF13632.13`	Glyco_trans_2_3	296	490	4.1e-19	69.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJP4`	Arabidopsis thaliana	Xyloglucan glycosyltransferase 4	72.368%	Swiss-Prot	strong database homology
`Q9SJA2`	Arabidopsis thaliana	Probable xyloglucan glycosyltransferase 8	67.899%	Swiss-Prot	strong database homology
`Q9SB75`	Arabidopsis thaliana	Probable xyloglucan glycosyltransferase 5	67.456%	Swiss-Prot	strong database homology
`Q69L19`	Oryza sativa subsp. japonica	Probable xyloglucan glycosyltransferase 2	65.249%	Swiss-Prot	strong database homology
`Q7PC70`	Oryza sativa subsp. indica	Probable xyloglucan glycosyltransferase 2	65.396%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card