LXL04_005993 | RubberDandelionOmics

Gene overview

LXL04_005993

Reference: OH-1004 Chr: Chr01 Coordinates: 176717122-176722072 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1972 bp · LXL04_005993|LXL04_005993|OH1004|cDNA

ATGGCTACCGCCTGCGCCTCCTCTGTTTCATGGAACTATCTCCCCAAGAACTACCATCAACGATCAAATATATTCTCCACTCCATCATGTCCCATTTCTTCAAAACCTCCACACAAGGAAACCCAATTTAATACGTCGCTCAAGGCCTTTAAAATTGCTTCAATTACAGCTCACGGCTCTCAATTCAAGTTTTTGAAACCGGGTACTCAAAGAACGAGGTCTAATCGAATCGTTTCGCTAAAATCTGCAGGCTCAGATAC...

CDS

Download CDS FASTA

1662 bp · LXL04_005993|LXL04_005993|OH1004|CDS

ATGGCTACCGCCTGCGCCTCCTCTGTTTCATGGAACTATCTCCCCAAGAACTACCATCAACGATCAAATATATTCTCCACTCCATCATGTCCCATTTCTTCAAAACCTCCACACAAGGAAACCCAATTTAATACGTCGCTCAAGGCCTTTAAAATTGCTTCAATTACAGCTCACGGCTCTCAATTCAAGTTTTTGAAACCGGGTACTCAAAGAACGAGGTCTAATCGAATCGTTTCGCTAAAATCTGCAGGCTCAGATAC...

Protein

Download Protein FASTA

553 aa · LXL04_005993|LXL04_005993|OH1004|PROTEIN

MATACASSVSWNYLPKNYHQRSNIFSTPSCPISSKPPHKETQFNTSLKAFKIASITAHGSQFKFLKPGTQRTRSNRIVSLKSAGSDTSITSNLLQTALGVVHLAVSLGIILAADKYLKQAFVAAAIKFPSALFGMFCIFTVLVILDVTIPAAATALVNFFEPALLFIQRWLPLFYVPSLVVLPLAVQDIPAASGLKICFILGWLASLAVAGYTAIAVRKMVKTEMIAAEPMAKPSAFSTLEVVAWSVISVASFVAALKYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005993`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005993

Location Chr01:176717122-176722072 (+)

Description Similar to PLGG1: Plastidal glycolate/glycerate translocator 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32080`	Glycolate/glycerate transporter required for photorespiration.	A chloroplast envelope membrane protein containing a putative LrgB domain related to the control of bacterial death and lysis is required for chloroplast development in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1469-8137.2011.03867.x Loss of the plastid envelope protein AtLrgB causes spontaneous chlorotic cell death in Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcr180

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005993 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009853 photorespiration Biological Process

GO:0010118 stomatal movement Biological Process

GO:0012501 programmed cell death Biological Process

GO:0019835 cytolysis Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0048527 lateral root development Biological Process

GO:0097339 glycolate transmembrane transport Biological Process

GO:1901975 glycerate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32080

bsu:BSU38330

sep:SE_2014

ser:SERP2027

ssp:SSP0461

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_005993 · OH-1004

Mitochondrion0.022

Rank 2 · LXL04_005993 · OH-1004

Cell membrane0.012

Rank 3 · LXL04_005993 · OH-1004

Nucleus0.011

Rank 4 · LXL04_005993 · OH-1004

Cytoplasm0.010

Rank 5 · LXL04_005993 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04172.22LrgB348-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005993	`PF04172.22`	LrgB	348	503	2.2e-34	119.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVQ4`	Arabidopsis thaliana	Plastidal glycolate/glycerate translocator 1, chloroplastic	74.607%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card