LXL04_005958 | RubberDandelionOmics

Gene overview

LXL04_005958

Reference: OH-1004 Chr: Chr01 Coordinates: 176364126-176365825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_005958|LXL04_005958|OH1004|cDNA

ATGGCTTCCATCGCAGGATCTTCAACTTTCATGGCTTCTCTTTCATGCCACAAGCCCAGTCAGGCACTTACCCGCACTTCTAATTTCTATGCGGTATCACTTGCTACCAACGGAAAATCCTTCACATCTCTTAAATTGCATTCTTCCCCATCACGCCTCAGGATTTCCTGTGCGGCCAAACCAGAGACAGTTGAAAAGGTTTGCGGCATTGTTAGGAAGCAACTTGCACTTCCAGAAGACTCTGCTGTCACTGGTGAATC...

CDS

Download CDS FASTA

528 bp · LXL04_005958|LXL04_005958|OH1004|CDS

ATGGCTTCCATCGCAGGATCTTCAACTTTCATGGCTTCTCTTTCATGCCACAAGCCCAGTCAGGCACTTACCCGCACTTCTAATTTCTATGCGGTATCACTTGCTACCAACGGAAAATCCTTCACATCTCTTAAATTGCATTCTTCCCCATCACGCCTCAGGATTTCCTGTGCGGCCAAACCAGAGACAGTTGAAAAGGTTTGCGGCATTGTTAGGAAGCAACTTGCACTTCCAGAAGACTCTGCTGTCACTGGTGAATC...

Protein

Download Protein FASTA

175 aa · LXL04_005958|LXL04_005958|OH1004|PROTEIN

MASIAGSSTFMASLSCHKPSQALTRTSNFYAVSLATNGKSFTSLKLHSSPSRLRISCAAKPETVEKVCGIVRKQLALPEDSAVTGESKFASLGADSLDTVEIVMGLEEEFGISVEEESAQTIATVQDAADLIEKLIEKKQNLYEIVLVFKDNDAHNELRNILIEHLWDDYVNSEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005958`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005958`
Location	Chr01:176364126-176365825 (-)
Description	Similar to ACP1: Acyl carrier protein 1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005958` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009507 chloroplast Cellular Component GO:0000036 acyl carrier activity Molecular Function GO:0031177 phosphopantetheine binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · LXL04_005958 · OH-1004

Mitochondrion0.022

Rank 2 · LXL04_005958 · OH-1004

Nucleus0.014

Rank 3 · LXL04_005958 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_005958 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_005958 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00550.32PP-binding65-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005958	`PF00550.32`	PP-binding	65	132	2e-10	41.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card