LXL04_005872 | RubberDandelionOmics

Gene overview

LXL04_005872

Reference: OH-1004 Chr: Chr01 Coordinates: 174852376-174854304 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_005872|LXL04_005872|OH1004|cDNA

ATGTTGGGTGTCAAATCAAGAAATCTTCGAATGGTTCCGCCGGTAAAAAGTGGAGCTTCCACCACTGGCGGTGGTGGTAGGGATGTCGGTGTGGCTGCTTGGGAACTCAGGCCATGTGGAATGTTGGTGCAGAAGAGGAATTCAGATGTTACTCAAAGTCAAAACATAGTTCCTACCATTAAAGTCAAAGTCAAATACTGTTCATCCTATCATGAAGTCAACATTAGATCTCAAGCAACTTTTGGAGAATTGAAGAAAAT...

CDS

Download CDS FASTA

864 bp · LXL04_005872|LXL04_005872|OH1004|CDS

ATGTTGGGTGTCAAATCAAGAAATCTTCGAATGGTTCCGCCGGTAAAAAGTGGAGCTTCCACCACTGGCGGTGGTGGTAGGGATGTCGGTGTGGCTGCTTGGGAACTCAGGCCATGTGGAATGTTGGTGCAGAAGAGGAATTCAGATGTTACTCAAAGTCAAAACATAGTTCCTACCATTAAAGTCAAAGTCAAATACTGTTCATCCTATCATGAAGTCAACATTAGATCTCAAGCAACTTTTGGAGAATTGAAGAAAAT...

Protein

Download Protein FASTA

287 aa · LXL04_005872|LXL04_005872|OH1004|PROTEIN

MLGVKSRNLRMVPPVKSGASTTGGGGRDVGVAAWELRPCGMLVQKRNSDVTQSQNIVPTIKVKVKYCSSYHEVNIRSQATFGELKKMLAGPTGLNPLDQKIVFRDKERDSKAYLDVAGVKDGSRMVLFDDIFSREKRLVENIKSPKMEKAKKEIVDVTTEIDKLVKQVGNLEIEIYSGKKVEEKVLLNLIELLMSQLIKLDGIIADGDVKLQRRVQVKRVQKYIENLDVMKIRNSKNASNGGWANIQVPLQQHPNKVSFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005872`
TK1151 ID	TkA01G010710
OH-1004 ID	LXL04_005872
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005872

Location Chr01:174852376-174854304 (-)

Description Similar to BAG1: BAG family molecular chaperone regulator 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52060`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release
`At5g07220`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release
`At5g62100`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release
`At3g51780`	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005872 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0043268 positive regulation of potassium ion transport Biological Process

GO:0050821 protein stabilization Biological Process

GO:0071629 cytoplasm protein quality control by the ubiquitin-proteasome system Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT3G51780

ath:AT5G07220

ath:AT5G52060

ath:AT5G62100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_005872 · OH-1004

Nucleus0.373

Rank 2 · LXL04_005872 · OH-1004

Cell membrane0.196

Rank 3 · LXL04_005872 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_005872 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_005872 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02179.22BAG154-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005872	`PF02179.22`	BAG	154	229	6.8e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUQ1`	Arabidopsis thaliana	BAG family molecular chaperone regulator 1	47.826%	Swiss-Prot	moderate database homology
`Q9LYP4`	Arabidopsis thaliana	BAG family molecular chaperone regulator 3	44.326%	Swiss-Prot	moderate database homology
`Q0WPX7`	Arabidopsis thaliana	BAG family molecular chaperone regulator 2	41.818%	Swiss-Prot	moderate database homology
`Q8RX71`	Arabidopsis thaliana	BAG family molecular chaperone regulator 4	39.535%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card