LXL04_005865 | RubberDandelionOmics

Gene overview

LXL04_005865

Reference: OH-1004 Chr: Chr01 Coordinates: 174758858-174762442 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2082 bp · LXL04_005865|LXL04_005865|OH1004|cDNA

ATGGTTGCTTTCGGGAAAAAGTTAAAGGACAGACAAATCGAAGAATGGCAAGGATATTACATCAACTACAAGCTTATGAAGAAAAAAGTTAAACAATATGCTCGACAAATCGAAACCGGAGGTACCGAACATAGACACGTTCTCAAAGATTTTTCAAGAATGCTCGATACCCAGATTGAAAAGATCGTTCTTTTTTTACTGGAACAACAAGGGATTCTTTCAAGCAGGATAGCCAAGCTTGCAGAGCAACAAGAAACTCT...

CDS

Download CDS FASTA

2082 bp · LXL04_005865|LXL04_005865|OH1004|CDS

ATGGTTGCTTTCGGGAAAAAGTTAAAGGACAGACAAATCGAAGAATGGCAAGGATATTACATCAACTACAAGCTTATGAAGAAAAAAGTTAAACAATATGCTCGACAAATCGAAACCGGAGGTACCGAACATAGACACGTTCTCAAAGATTTTTCAAGAATGCTCGATACCCAGATTGAAAAGATCGTTCTTTTTTTACTGGAACAACAAGGGATTCTTTCAAGCAGGATAGCCAAGCTTGCAGAGCAACAAGAAACTCT...

Protein

Download Protein FASTA

693 aa · LXL04_005865|LXL04_005865|OH1004|PROTEIN

MVAFGKKLKDRQIEEWQGYYINYKLMKKKVKQYARQIETGGTEHRHVLKDFSRMLDTQIEKIVLFLLEQQGILSSRIAKLAEQQETLQMEFDLVKTADLREAYRDIGRDLLKLLFFVEINAIGLRKILKKFDKRFGYRFTDYYVKTRANHPYSQLQQVFKHVGLGAVVGAISRNLVELEDRQGSYQSIYDQPTRPLQDPVIDTIRAAVDRLSYSTNFLTFLGQHALIMHEELSMPTEETSDDQRYNFTSLFLNLMNTFLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005865`
TK1151 ID	TkA01G010920
OH-1004 ID	LXL04_005865
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005865

Location Chr01:174758858-174762442 (-)

Description Similar to At4g22990: SPX domain-containing membrane protein At4g22990

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22990`	SPX domain-containing membrane protein At4g22990.	No verified direct reference in this release
`At4g11810`	SPX domain-containing membrane protein At4g11810.	No verified direct reference in this release
`At1g63010`	SPX domain-containing membrane protein At1g63010.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0573000`	SPX domain-containing membrane protein Os04g0573000.	No verified direct reference in this release
`UniProt: B8AT51`	SPX domain-containing membrane protein OsI_17046.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005865 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:1905011 transmembrane phosphate ion transport from cytosol to vacuole Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005315 phosphate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G63010

ath:AT4G11810

ath:AT4G22990

dosa:Os04g0573000

osa:4336724

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.358

Rank 1 · LXL04_005865 · OH-1004

Golgi apparatus0.246

Rank 2 · LXL04_005865 · OH-1004

Cytoplasm0.223

Rank 3 · LXL04_005865 · OH-1004

Endoplasmic reticulum0.197

Rank 4 · LXL04_005865 · OH-1004

Cell membrane0.176

Rank 5 · LXL04_005865 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105.25SPX4-38 aa

PF03105.25SPX103-146 aa

PF07690.22MFS_1256-636 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005865	`PF03105.25`	SPX	4	38	1.5e-14	55.6
LXL04_005865	`PF03105.25`	SPX	103	146	1.5e-14	55.6
LXL04_005865	`PF07690.22`	MFS_1	256	636	2e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZQ5`	Arabidopsis thaliana	SPX domain-containing membrane protein At4g22990	74.184%	Swiss-Prot	strong database homology
`Q9T050`	Arabidopsis thaliana	SPX domain-containing membrane protein At4g11810	73.550%	Swiss-Prot	strong database homology
`Q2V4F9`	Arabidopsis thaliana	SPX domain-containing membrane protein At1g63010	72.740%	Swiss-Prot	strong database homology
`Q0JAW2`	Oryza sativa subsp. japonica	SPX domain-containing membrane protein Os04g0573000	67.145%	Swiss-Prot	strong database homology
`B8AT51`	Oryza sativa subsp. indica	SPX domain-containing membrane protein OsI_17046	67.145%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card