LXL04_005669 | RubberDandelionOmics

Gene overview

LXL04_005669

Reference: OH-1004 Chr: Chr01 Coordinates: 170693364-170697453 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2649 bp · LXL04_005669|LXL04_005669|OH1004|cDNA

ATGAGCAGCATTGCATCTCAGCCATTATCAACACCTCTCCAAATGGAACCACCTGTATCCAATCAAGACTCATCACTCAACAACATGGGCCCACAGAAGCCATTACTTCCTTCAAAACGAAAAGCTGCATCCGAATCCTTTTCCAACAACCCTTTATCCTCAATCCCAAACAAACGTGGTGTACTTCATATGGATGTAATCTCAAGTCCAagtccaaattcaaattcaaattcacCACTTTCTGTTAACAGGAAACAAAC...

CDS

Download CDS FASTA

2649 bp · LXL04_005669|LXL04_005669|OH1004|CDS

ATGAGCAGCATTGCATCTCAGCCATTATCAACACCTCTCCAAATGGAACCACCTGTATCCAATCAAGACTCATCACTCAACAACATGGGCCCACAGAAGCCATTACTTCCTTCAAAACGAAAAGCTGCATCCGAATCCTTTTCCAACAACCCTTTATCCTCAATCCCAAACAAACGTGGTGTACTTCATATGGATGTAATCTCAAGTCCAAGTCCAAATTCAAATTCAAATTCACCACTTTCTGTTAACAGGAAACAAAC...

Protein

Download Protein FASTA

882 aa · LXL04_005669|LXL04_005669|OH1004|PROTEIN

MSSIASQPLSTPLQMEPPVSNQDSSLNNMGPQKPLLPSKRKAASESFSNNPLSSIPNKRGVLHMDVISSPSPNSNSNSPLSVNRKQTQVPSSQPNKRMIRNESMSSNKTVSPRVQMSKSKTAPMEVSPKVQSESYVRAKMRDTLSAALSVGIQTKDEEPSKNASHEESGNGGPTADVAKPQYNYVMPETDDTFFVKDELLQGNGLSWAWDMEVVDEKSNPSQQSQTTETGTDNVNDTEEVVKESPQELAIKIEAELFKLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005669`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005669`
Location	Chr01:170693364-170697453 (-)
Description	Similar to PHF3: PHD finger protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005669` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0007283 spermatogenesis Biological Process GO:0030154 cell differentiation Biological Process GO:0141006 transposable element silencing by piRNA-mediated heterochromatin formation Biological Process GO:0141196 transposable element silencing by piRNA-mediated DNA methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005819 spindle Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	cel:CELE_T24H10.1 hsa:11083 hsa:23469 hsa:90853 mmu:23856 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · LXL04_005669 · OH-1004

Cytoplasm0.104

Rank 2 · LXL04_005669 · OH-1004

Cell membrane0.048

Rank 3 · LXL04_005669 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_005669 · OH-1004

Plastid0.015

Rank 5 · LXL04_005669 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07500.20TFIIS_M237-323 aa

PF07744.20SPOC498-643 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005669	`PF07500.20`	TFIIS_M	237	323	1e-28	100.7
LXL04_005669	`PF07744.20`	SPOC	498	643	6.5e-24	85.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card