LXL04_005477 | RubberDandelionOmics

Gene overview

LXL04_005477

Reference: OH-1004 Chr: Chr01 Coordinates: 165008378-165011394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_005477|LXL04_005477|OH1004|cDNA

ATGAGACGGGAGGGGCTCCATCTCGTGTGTGACGAGCGACTCAGCAACCCTAAACCCAATTTGCTCGTCGGCGAGGGGGAGAGAACCAGAGAGACAGCAGCGAGACCGAGAGAAAGAGTCATGTATTGCTCGTCGGCGAGAGGGAGAGACAGCAGCGACTCCTGCGTTTTCCGGCGTGTGCTGCTCCTCCTTCTCTGTTCTCCGGCGATCGTGAACCTTCCCAGCAGCCGATTGCAACGACAACAGATCTCATCCTGGGA...

CDS

Download CDS FASTA

1287 bp · LXL04_005477|LXL04_005477|OH1004|CDS

ATGAGACGGGAGGGGCTCCATCTCGTGTGTGACGAGCGACTCAGCAACCCTAAACCCAATTTGCTCGTCGGCGAGGGGGAGAGAACCAGAGAGACAGCAGCGAGACCGAGAGAAAGAGTCATGTATTGCTCGTCGGCGAGAGGGAGAGACAGCAGCGACTCCTGCGTTTTCCGGCGTGTGCTGCTCCTCCTTCTCTGTTCTCCGGCGATCGTGAACCTTCCCAGCAGCCGATTGCAACGACAACAGATCTCATCCTGGGA...

Protein

Download Protein FASTA

428 aa · LXL04_005477|LXL04_005477|OH1004|PROTEIN

MRREGLHLVCDERLSNPKPNLLVGEGERTRETAARPRERVMYCSSARGRDSSDSCVFRRVLLLLLCSPAIVNLPSSRLQRQQISSWECKQILGDFFKKYKIRGLSTDLDPRSLILELVLNTRINPRSLMLELFQFRCFCFRGLGYYDGAEVQGMVLSEQLIYASLVAEDYARRFESGDMVEGITKDLAADEQGLLNAKVMCRLCFSGENEEIERAKKMLSCKNCNKKYHRTCVKSWAQNRDLFHWSSWTCPSCRTCEVCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005477`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005477`
Location	Chr01:165008378-165011394 (+)
Description	Similar to Kmt2d: Histone-lysine N-methyltransferase 2D
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005477` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010468 regulation of gene expression Biological Process GO:0031507 heterochromatin formation Biological Process GO:0032259 methylation Biological Process GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0043627 response to estrogen Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1904837 beta-catenin-TCF complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	hsa:58508 hsa:8085 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.829

Rank 1 · LXL04_005477 · OH-1004

Cytoplasm0.192

Rank 2 · LXL04_005477 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_005477 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_005477 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_005477 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00628.36PHD201-253 aa

PF00628.36PHD256-299 aa

PF23004.3PHDvar_NSD256-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005477	`PF00628.36`	PHD	201	253	3.4e-11	43.7
LXL04_005477	`PF00628.36`	PHD	256	299	3.4e-11	43.7
LXL04_005477	`PF23004.3`	PHDvar_NSD	256	301	4.7e-08	33.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card