LXL04_005397 | RubberDandelionOmics

Gene overview

LXL04_005397

Reference: OH-1004 Chr: Chr01 Coordinates: 162618435-162624740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2286 bp · LXL04_005397|LXL04_005397|OH1004|cDNA

ATGCCGAGAATTACTTTCCATGATAAAATACGCTTCGTACAACCCTCAATAATTGGCGGGTCTGGTGGTGGTTACTTTGCGCAACGATGGAGAAACAATTTACAGATGGCATCTGAGATTGGAAAAGTCGATGACCGGAGGAAGACGTATCTGTTGGCCTTTTTAGAAATGGCGTTTTGGTGGGCTTTGATCGTGATAGCATTCGCCTTTGTGATCTGTAAATTTCTACTGATGCTCATTCCTTCCAATGTGCCTTCAAT...

CDS

Download CDS FASTA

2286 bp · LXL04_005397|LXL04_005397|OH1004|CDS

ATGCCGAGAATTACTTTCCATGATAAAATACGCTTCGTACAACCCTCAATAATTGGCGGGTCTGGTGGTGGTTACTTTGCGCAACGATGGAGAAACAATTTACAGATGGCATCTGAGATTGGAAAAGTCGATGACCGGAGGAAGACGTATCTGTTGGCCTTTTTAGAAATGGCGTTTTGGTGGGCTTTGATCGTGATAGCATTCGCCTTTGTGATCTGTAAATTTCTACTGATGCTCATTCCTTCCAATGTGCCTTCAAT...

Protein

Download Protein FASTA

761 aa · LXL04_005397|LXL04_005397|OH1004|PROTEIN

MPRITFHDKIRFVQPSIIGGSGGGYFAQRWRNNLQMASEIGKVDDRRKTYLLAFLEMAFWWALIVIAFAFVICKFLLMLIPSNVPSIDVDASDVIDDGHPKENSFIYIPSRRQTDKVQCYEPATMKYLGYFLALKPDEVKERVAQVRKSQKVWAKSSFKQRRQFLRVLLKYIIEHQQLICEISSRDTGKTMVDASLGEIMTTCEKITWLLSEGERWLKPEYMSMLHKTSKVEYHPLGVVGAIVSWNYPFHNLFNPVLAAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005397`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005397

Location Chr01:162618435-162624740 (+)

Description Similar to ALDH22A1: Aldehyde dehydrogenase 22A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g66658`	Aldehyde dehydrogenase 22A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005397 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006081 aldehyde metabolic process Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0019285 glycine betaine biosynthetic process from choline Biological Process

GO:0110095 cellular detoxification of aldehyde Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004029 aldehyde dehydrogenase (NAD+) activity Molecular Function

KEGG gene cross-reference

ag:AAX46184

ath:AT3G66658

sce:YHR039C

sly:101253497

spo:2540508

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.351

Rank 1 · LXL04_005397 · OH-1004

Cytoplasm0.197

Rank 2 · LXL04_005397 · OH-1004

Mitochondrion0.147

Rank 3 · LXL04_005397 · OH-1004

Golgi apparatus0.102

Rank 4 · LXL04_005397 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_005397 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171.28Aldedh113-363 aa

PF00171.28Aldedh401-547 aa

PF01419.23Jacalin617-748 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005397	`PF00171.28`	Aldedh	113	363	2.4e-98	330.4
LXL04_005397	`PF00171.28`	Aldedh	401	547	2.4e-98	330.4
LXL04_005397	`PF01419.23`	Jacalin	617	748	3.5e-22	80.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WSF1`	Arabidopsis thaliana	Aldehyde dehydrogenase 22A1	71.256%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card