LXL04_004801 | RubberDandelionOmics

Gene overview

LXL04_004801

Reference: OH-1004 Chr: Chr01 Coordinates: 147053619-147054697 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · LXL04_004801|LXL04_004801|OH1004|cDNA

AAAAATATAAGAggaaaatcagaaaaaaatAAACAATTGCTCTTCCATATATTTCAAATCCTGCCATCTATAAATTACGTTCTCCATTCGCTTGTAACACACAAACGCACTATGGACGCTTTGCCAAACAGATTAGAAGGCAAAGTAGCCATAGTCACCGGCGGTGCTAGTGGCATCGGTGAAAGCACGGTGAGGCTGTTCGTTAAATATGGCGCCAAAGTCGTGATAGCAGACGTACAAGATGATTTGGGACTTTCTCT...

CDS

Download CDS FASTA

915 bp · LXL04_004801|LXL04_004801|OH1004|CDS

TTGCTCTTCCATATATTTCAAATCCTGCCATCTATAAATTACGTTCTCCATTCGCTTGTAACACACAAACGCACTATGGACGCTTTGCCAAACAGATTAGAAGGCAAAGTAGCCATAGTCACCGGCGGTGCTAGTGGCATCGGTGAAAGCACGGTGAGGCTGTTCGTTAAATATGGCGCCAAAGTCGTGATAGCAGACGTACAAGATGATTTGGGACTTTCTCTTTGTAACGATCTGGCGTCTAAATCCGGCGAAAATGT...

Protein

Download Protein FASTA

304 aa · LXL04_004801|LXL04_004801|OH1004|PROTEIN

MLFHIFQILPSINYVLHSLVTHKRTMDALPNRLEGKVAIVTGGASGIGESTVRLFVKYGAKVVIADVQDDLGLSLCNDLASKSGENVIYVHCDVTQESDVENAVDTAVSKFGKLDIMFNNAGIPGNLDFKILESDNENFKRVFDVNAFGSFLGAKHAARVMIPAKRGAILFTSSSASVVAGESPHAYTVSKHAVVGLMKNLCVELGQHGIRVNCISPGSVSTPLLTNAMGLGKATVDDILCAAAVLKEVVPTAEDIAEAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004801`
TK1151 ID	TkA01G109940
OH-1004 ID	LXL04_004801
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 96.203 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_004801`
Location	Chr01:147053619-147054697 (+)
Description	Similar to Secoisolariciresinol dehydrogenase (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004801` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009411 response to UV Biological Process GO:0009611 response to wounding Biological Process GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009807 lignan biosynthetic process Biological Process GO:0016099 monoterpenoid biosynthetic process Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0044283 small molecule biosynthetic process Biological Process GO:0051289 protein homotetramerization Biological Process GO:0005739 mitochondrion Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function
KEGG gene cross-reference	ag:AAK38664 ag:ABN14311 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.682

Rank 1 · LXL04_004801 · OH-1004

Nucleus0.280

Rank 2 · LXL04_004801 · OH-1004

Peroxisome0.158

Rank 3 · LXL04_004801 · OH-1004

Mitochondrion0.080

Rank 4 · LXL04_004801 · OH-1004

Plastid0.050

Rank 5 · LXL04_004801 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23441.1SDR31-281 aa

PF00106.32adh_short36-227 aa

PF08659.17KR38-199 aa

PF13561.13adh_short_C244-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004801	`PF23441.1`	SDR	31	281	4.5e-11	43.3
LXL04_004801	`PF00106.32`	adh_short	36	227	6e-54	183.2
LXL04_004801	`PF08659.17`	KR	38	199	9.1e-11	42.7
LXL04_004801	`PF13561.13`	adh_short_C2	44	283	1e-65	222.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card