LXL04_004731 | RubberDandelionOmics

Gene overview

LXL04_004731

Reference: OH-1004 Chr: Chr01 Coordinates: 144794352-144795906 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_004731|LXL04_004731|OH1004|cDNA

ATGTATCCTCGAAGCCACCAACCATCAACAACACCACTAGGACATCCTATGTACCATTCTCCCACCAAACTGACTCCTAAGACCAAGTACACGGACAACAAACACACTGTGCGACGTGTCAACCGTACTCCCGCAAAACAGACTCCTAAGTCCAAATACACGGACAACAAACCCACTGTGCGATCTGTAAACCCTACTCCCACAAAACAGACTCCTAAGTCCAGGTACACAGACAACAAACCCACTGTGCGACTTGTAAA...

CDS

Download CDS FASTA

921 bp · LXL04_004731|LXL04_004731|OH1004|CDS

ATGTATCCTCGAAGCCACCAACCATCAACAACACCACTAGGACATCCTATGTACCATTCTCCCACCAAACTGACTCCTAAGACCAAGTACACGGACAACAAACACACTGTGCGACGTGTCAACCGTACTCCCGCAAAACAGACTCCTAAGTCCAAATACACGGACAACAAACCCACTGTGCGATCTGTAAACCCTACTCCCACAAAACAGACTCCTAAGTCCAGGTACACAGACAACAAACCCACTGTGCGACTTGTAAA...

Protein

Download Protein FASTA

306 aa · LXL04_004731|LXL04_004731|OH1004|PROTEIN

MYPRSHQPSTTPLGHPMYHSPTKLTPKTKYTDNKHTVRRVNRTPAKQTPKSKYTDNKPTVRSVNPTPTKQTPKSRYTDNKPTVRLVNPTPAKQTPKSKYTDNKPTMRPVYSTPANQTPKTKYTDNKPTVRFYCKAKPNYSLTIRNGSVVFALTNCSDPYQHWIFEKKFGMTVKDKEGFPSFSLVNKATGQALYHASGSTKQVRLRQYNPDKVEESVLWTHSKDLGDGFHVVRMVNNIKLNLDSSILNSIRYGTRVWLGTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004731`
TK1151 ID	TkA01G118100
OH-1004 ID	LXL04_004731
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 89.216 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004731

Location Chr01:144794352-144795906 (+)

Description Similar to R40G3: Ricin B-like lectin R40G3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39050`	Lectin which binds carbohydrates in vitro.	The Arabidopsis lectin EULS3 is involved in stomatal closure.2015 · DOI: 10.1016/j.plantsci.2015.07.005

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0684000`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release
`Os03g0327600`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release
`Os07g0683900`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G39050

dosa:Os03g0327600

dosa:Os07g0683900

dosa:Os07g0684000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.678

Rank 1 · LXL04_004731 · OH-1004

Cytoplasm0.176

Rank 2 · LXL04_004731 · OH-1004

Endoplasmic reticulum0.053

Rank 3 · LXL04_004731 · OH-1004

Nucleus0.050

Rank 4 · LXL04_004731 · OH-1004

Lysosome / Vacuole0.050

Rank 5 · LXL04_004731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945P1`	Arabidopsis thaliana	Ricin B-like lectin EULS3	49.333%	Swiss-Prot	weak database homology
`Q6Z4N4`	Oryza sativa subsp. japonica	Ricin B-like lectin R40G3	51.020%	Swiss-Prot	weak database homology
`Q10M12`	Oryza sativa subsp. japonica	Ricin B-like lectin R40C1	44.379%	Swiss-Prot	moderate database homology
`Q6Z4N6`	Oryza sativa subsp. japonica	Ricin B-like lectin R40G2	46.207%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card