LXL04_004207 | RubberDandelionOmics

Gene overview

LXL04_004207

Reference: OH-1004 Chr: Chr01 Coordinates: 129386433-129387506 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · LXL04_004207|LXL04_004207|OH1004|cDNA

ATGAGATCGCCGTCCAAATCCGTAACTAAAAGGGTCAGAGATGCCGAATCTGAGTTGAATTTGCCTCCGGGCTTCCGATTTCACCCAACGGACGAGGAGCTCATTGTTCACTATCTCTGTCGCAAGTCCCAAACGGCGGAGGTGATCACTGGCGTCGCTCCACCACCACCTATCATCGCCGATATTGATCTCTACAAGCACGATCCATGGGAGCTTCCTGATTTGGCTCTGTTTGGAACAAAGGAATGGTACTTCTTCAC...

CDS

Download CDS FASTA

900 bp · LXL04_004207|LXL04_004207|OH1004|CDS

ATGAGATCGCCGTCCAAATCCGTAACTAAAAGGGTCAGAGATGCCGAATCTGAGTTGAATTTGCCTCCGGGCTTCCGATTTCACCCAACGGACGAGGAGCTCATTGTTCACTATCTCTGTCGCAAGTCCCAAACGGCGGAGGTGATCACTGGCGTCGCTCCACCACCACCTATCATCGCCGATATTGATCTCTACAAGCACGATCCATGGGAGCTTCCTGATTTGGCTCTGTTTGGAACAAAGGAATGGTACTTCTTCAC...

Protein

Download Protein FASTA

299 aa · LXL04_004207|LXL04_004207|OH1004|PROTEIN

MRSPSKSVTKRVRDAESELNLPPGFRFHPTDEELIVHYLCRKSQTAEVITGVAPPPPIIADIDLYKHDPWELPDLALFGTKEWYFFTPRDRKYPNGSRPNRVTGNGYWKATGADKPIKRKSDSNRIVGIKKALVFYTGKGVKGIKTNWIMHEYRLPIPDTTTSKHSKLENWVLCRVYNKKNNPKEKIVPEDNNNRSIGDLIHPTSPFDESQTNNSDSMHSFENSDGEFGGNFEGDVMFLNDLPEESLTKVKGTSGQSTML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004207`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004207

Location Chr01:129386433-129387506 (-)

Description Similar to NAC068: NAC domain-containing protein 68

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08790`	Involved in disease resistance response.	The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02488.x Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses.2009 · DOI: 10.1128/jvi.00941-09 ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis.2012 · DOI: 10.1007/s10059-012-0122-2 ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis.2015 · DOI: 10.1242/dev.124347
`At1g01720`	NAC domain-containing protein 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0816100`	Probable transcription factor involved in stress response.	No verified direct reference in this release
`Os03g0815100`	Transcription factor that possesses transactivation activity.	Overexpressing a NAM, ATAF, and CUC (NAC) transcription factor enhances drought resistance and salt tolerance in rice.2006 · DOI: 10.1073/pnas.0604882103 The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.2010 · DOI: 10.1007/s00438-010-0557-0
`Os07g0225300`	Probable transcription factor involved in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G01720

ath:AT5G08790

dosa:Os01g0816100

dosa:Os03g0815100

dosa:Os07g0225300

osa:4334553

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_004207 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_004207 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_004207 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_004207 · OH-1004

Plastid0.015

Rank 5 · LXL04_004207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM22-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004207	`PF02365.21`	NAM	22	155	2.9e-47	160.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C598`	Arabidopsis thaliana	Protein ATAF2	53.219%	Swiss-Prot	strong database homology
`Q39013`	Arabidopsis thaliana	NAC domain-containing protein 2	66.667%	Swiss-Prot	moderate database homology
`Q52QH4`	Oryza sativa subsp. japonica	NAC domain-containing protein 68	65.079%	Swiss-Prot	moderate database homology
`Q75HE5`	Oryza sativa subsp. japonica	NAC domain-containing protein 2	64.205%	Swiss-Prot	moderate database homology
`Q7EZT1`	Oryza sativa subsp. japonica	NAC domain-containing protein 67	62.011%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card