LXL04_003239 | RubberDandelionOmics

Gene overview

LXL04_003239

Reference: OH-1004 Chr: Chr01 Coordinates: 71670655-71671379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

267 bp · LXL04_003239|LXL04_003239|OH1004|cDNA

ATGATTATTCTTTCTGCTGCTGTTGGCATGGCCGCTCCAAACCTGCATATAACCACTGTGTTGTTTTTTGGTTTTGGACTATGGTTTTTATGGGATGCATATAAAGATGGGGAATTTGAAGAGTTGGCTGAAGTTGAAGATGAACTAATAAGTGATGATGCtttaaagaaaaagaagagacCATTGTTGACTCAATTTATTCCACCCATGTTTCTTAAAGCCTTTTCCATAATTTTTTTTGGAGAATGGGGTGAAAAAGC...

CDS

Download CDS FASTA

267 bp · LXL04_003239|LXL04_003239|OH1004|CDS

ATGATTATTCTTTCTGCTGCTGTTGGCATGGCCGCTCCAAACCTGCATATAACCACTGTGTTGTTTTTTGGTTTTGGACTATGGTTTTTATGGGATGCATATAAAGATGGGGAATTTGAAGAGTTGGCTGAAGTTGAAGATGAACTAATAAGTGATGATGCTTTAAAGAAAAAGAAGAGACCATTGTTGACTCAATTTATTCCACCCATGTTTCTTAAAGCCTTTTCCATAATTTTTTTTGGAGAATGGGGTGAAAAAGC...

Protein

Download Protein FASTA

88 aa · LXL04_003239|LXL04_003239|OH1004|PROTEIN

MIILSAAVGMAAPNLHITTVLFFGFGLWFLWDAYKDGEFEELAEVEDELISDDALKKKKRPLLTQFIPPMFLKAFSIIFFGEWGEKAR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003239`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003239

Location Chr01:71670655-71671379 (-)

Description Similar to At1g68650: GDT1-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68650`	GDT1-like protein 5.	No verified direct reference in this release
`At1g25520`	GDT1-like protein 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0433100`	GDT1-like protein 5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003239 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032468 Golgi calcium ion homeostasis Biological Process

GO:0032472 Golgi calcium ion transport Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071421 manganese ion transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:0005384 manganese ion transmembrane transporter activity Molecular Function

GO:0015085 calcium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G25520

ath:AT1G68650

dosa:Os08g0433100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.504

Rank 1 · LXL04_003239 · OH-1004

Golgi apparatus0.131

Rank 2 · LXL04_003239 · OH-1004

Plastid0.096

Rank 3 · LXL04_003239 · OH-1004

Lysosome / Vacuole0.079

Rank 4 · LXL04_003239 · OH-1004

Cytoplasm0.073

Rank 5 · LXL04_003239 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX28`	Arabidopsis thaliana	GDT1-like protein 5	49.091%	Swiss-Prot	moderate database homology
`Q9C6M1`	Arabidopsis thaliana	GDT1-like protein 4	46.429%	Swiss-Prot	moderate database homology
`B9G125`	Oryza sativa subsp. japonica	GDT1-like protein 5	39.640%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card