LXL04_003188 | RubberDandelionOmics

Gene overview

LXL04_003188

Reference: OH-1004 Chr: Chr01 Coordinates: 70419028-70421648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · LXL04_003188|LXL04_003188|OH1004|cDNA

ATGGTGAAGAACCCATCGCATCAAGACCTCGATTCACCAACTTACATGGCTACATTGAAGAAATTTAAGCCGTTTAAACTTTTCGAACCCTCATTGGGCATACTGGGTTTTTTGTTCGTTACAGTTTGTATAATTTTTGGGTTTATTTATTTGGATTACAGAAATGTAGTTACAGGCGGTGTATTTCGATTTTCGAATGGGATAGAGAGGCTTAAGTGGTTAAAGTTCGGAGGTAGCAGTGAAGTTTATAGTAGAAAAAG...

CDS

Download CDS FASTA

1377 bp · LXL04_003188|LXL04_003188|OH1004|CDS

ATGGTGAAGAACCCATCGCATCAAGACCTCGATTCACCAACTTACATGGCTACATTGAAGAAATTTAAGCCGTTTAAACTTTTCGAACCCTCATTGGGCATACTGGGTTTTTTGTTCGTTACAGTTTGTATAATTTTTGGGTTTATTTATTTGGATTACAGAAATGTAGTTACAGGCGGTGTATTTCGATTTTCGAATGGGATAGAGAGGCTTAAGTGGTTAAAGTTCGGAGGTAGCAGTGAAGTTTATAGTAGAAAAAG...

Protein

Download Protein FASTA

458 aa · LXL04_003188|LXL04_003188|OH1004|PROTEIN

MVKNPSHQDLDSPTYMATLKKFKPFKLFEPSLGILGFLFVTVCIIFGFIYLDYRNVVTGGVFRFSNGIERLKWLKFGGSSEVYSRKRVDFLSVDGDGCDVFEGDWLWDEKYPLYESKDCRFLDEGFRCSENGRPDFLFTKWRWQPKDCNLPRFNGTRMLESMRNKRIVFVGDSIGRNQWESLLCMMSSSITSTNKNNNDSIYEVNGNPITKHKGFLVFKFRDYNCTLEYYRAPFLVLQSRPPPDSPSKIRTTLKLDQMDW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003188`
TK1151 ID	TkA01G387040
OH-1004 ID	LXL04_003188
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 54.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003188

Location Chr01:70419028-70421648 (+)

Description Similar to TBL11: Protein trichome birefringence-like 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19160`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g06080`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06230`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g11570`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g62390`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003188 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G06080

ath:AT3G11570

ath:AT3G62390

ath:AT5G06230

ath:AT5G19160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.705

Rank 1 · LXL04_003188 · OH-1004

Cell membrane0.073

Rank 2 · LXL04_003188 · OH-1004

Endoplasmic reticulum0.061

Rank 3 · LXL04_003188 · OH-1004

Extracellular0.051

Rank 4 · LXL04_003188 · OH-1004

Nucleus0.031

Rank 5 · LXL04_003188 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N97-149 aa

PF13839.13PC-Esterase150-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003188	`PF14416.12`	PMR5N	97	149	2.1e-21	76.7
LXL04_003188	`PF13839.13`	PC-Esterase	150	447	9.2e-101	338.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5BPJ0`	Arabidopsis thaliana	Protein trichome birefringence-like 11	59.259%	Swiss-Prot	strong database homology
`Q9LDG2`	Arabidopsis thaliana	Protein trichome birefringence-like 10	60.090%	Swiss-Prot	strong database homology
`Q9FFZ4`	Arabidopsis thaliana	Protein trichome birefringence-like 9	48.333%	Swiss-Prot	moderate database homology
`Q9CAX1`	Arabidopsis thaliana	Protein trichome birefringence-like 8	50.000%	Swiss-Prot	strong database homology
`Q9LZQ1`	Arabidopsis thaliana	Protein trichome birefringence-like 6	45.251%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card