LXL04_002927 | RubberDandelionOmics

Gene overview

LXL04_002927

Reference: OH-1004 Chr: Chr01 Coordinates: 61405560-61409153 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · LXL04_002927|LXL04_002927|OH1004|cDNA

ATGCAATCGGATTCCGTAAAAGTGTCGCCGTTTGATCTGATGTCTGCGGTCTTTAACGGGAAAGTAATGGATGCATTGAACGCATCGGAATCGGGAGAATTGACGATTACACCGACATTGAAGATGCTGGTGGAGAATCGTGAGTTACTGACGTTGTTTACAACGTCCGTTGCTGTGTTGATAGGATGTTTCGTCGTTTTGGTGTGGCGGAGATCGTCTACCAAGAAACTAGTTGAAGATGTGAAGCCAGAGCAGATCGT...

CDS

Download CDS FASTA

2127 bp · LXL04_002927|LXL04_002927|OH1004|CDS

ATGCAATCGGATTCCGTAAAAGTGTCGCCGTTTGATCTGATGTCTGCGGTCTTTAACGGGAAAGTAATGGATGCATTGAACGCATCGGAATCGGGAGAATTGACGATTACACCGACATTGAAGATGCTGGTGGAGAATCGTGAGTTACTGACGTTGTTTACAACGTCCGTTGCTGTGTTGATAGGATGTTTCGTCGTTTTGGTGTGGCGGAGATCGTCTACCAAGAAACTAGTTGAAGATGTGAAGCCAGAGCAGATCGT...

Protein

Download Protein FASTA

708 aa · LXL04_002927|LXL04_002927|OH1004|PROTEIN

MQSDSVKVSPFDLMSAVFNGKVMDALNASESGELTITPTLKMLVENRELLTLFTTSVAVLIGCFVVLVWRRSSTKKLVEDVKPEQIVVPKREKEPEVDDGKKKVTIFFGTQTGTAEGFAKALLEEAKVRYEKASFKAVDLDDYAADDDEYEERLKKESYAFFFLATYGDGEPTDNAARFYKWFTEGDAKGEWLNKLHYGVFGLGNRQYEHFNKIAIVVDEALAEQGAKRLVPVGLGDDDQCIEDDFGAWKEMVWPELDQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002927`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002927

Location Chr01:61405560-61409153 (-)

Description Similar to CPR: NADPH--cytochrome P450 reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30210`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0558900`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes (By similarity).	Rice P450 reductases differentially affect P450-mediated metabolism in bacterial expression systems.2013 · DOI: 10.1007/s00449-012-0787-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002927 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003958 NADPH-hemoprotein reductase activity Molecular Function

GO:0010181 FMN binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G30210

dosa:Os09g0558900

osa:4347838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.355

Rank 1 · LXL04_002927 · OH-1004

Mitochondrion0.253

Rank 2 · LXL04_002927 · OH-1004

Endoplasmic reticulum0.208

Rank 3 · LXL04_002927 · OH-1004

Nucleus0.149

Rank 4 · LXL04_002927 · OH-1004

Golgi apparatus0.107

Rank 5 · LXL04_002927 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00258.31Flavodoxin_1106-249 aa

PF00667.27FAD_binding_1304-525 aa

PF00175.27NAD_binding_1562-672 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002927	`PF00258.31`	Flavodoxin_1	106	249	2e-30	106.5
LXL04_002927	`PF00667.27`	FAD_binding_1	304	525	1.2e-68	231.8
LXL04_002927	`PF00175.27`	NAD_binding_1	562	672	2.1e-18	67.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUM3`	Arabidopsis thaliana	NADPH--cytochrome P450 reductase 2	72.238%	Swiss-Prot	strong database homology
`Q653S9`	Oryza sativa subsp. japonica	NADPH--cytochrome P450 reductase 3	68.067%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card