LXL04_002810 | RubberDandelionOmics

Gene overview

LXL04_002810

Reference: OH-1004 Chr: Chr01 Coordinates: 58739379-58742167 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · LXL04_002810|LXL04_002810|OH1004|cDNA

ATGGCTTGCAGACTCACAGATTCTAGTTTCCTTTTGAAGGGTCCCCAACAAAAGCGAATTCATGGTCATAGATTTGTGTCACTATATCCAACAGGTATGAATCCTTACTCTGGCTGTTTAATTTGGCGATATCGGACAGGCACATCTCTTTTGAAGTGGGAATCTCTACCTCAACACAAACccaaaaaccaaaaatatataattcCTTTAAGAAGGGGTAAAATCGTAAAAGCAGTAGCCAGTCCTATCACACCACCATT...

CDS

Download CDS FASTA

1374 bp · LXL04_002810|LXL04_002810|OH1004|CDS

ATGGCTTGCAGACTCACAGATTCTAGTTTCCTTTTGAAGGGTCCCCAACAAAAGCGAATTCATGGTCATAGATTTGTGTCACTATATCCAACAGGTATGAATCCTTACTCTGGCTGTTTAATTTGGCGATATCGGACAGGCACATCTCTTTTGAAGTGGGAATCTCTACCTCAACACAAACCCAAAAACCAAAAATATATAATTCCTTTAAGAAGGGGTAAAATCGTAAAAGCAGTAGCCAGTCCTATCACACCACCATT...

Protein

Download Protein FASTA

457 aa · LXL04_002810|LXL04_002810|OH1004|PROTEIN

MACRLTDSSFLLKGPQQKRIHGHRFVSLYPTGMNPYSGCLIWRYRTGTSLLKWESLPQHKPKNQKYIIPLRRGKIVKAVASPITPPFPLDSAERRQELCESYGFRQIGEPLPDNITLKNIIDSLPKSVFEIDNVKAWKSVLISLTSYALGLFMIAKSPWYLLPLAWAWTGTAITGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHDRHHAKTNMLKEDTAWHPVMKKHFEESPVFQKAIVFGYGPIRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002810`
TK1151 ID	TkA01G419220
OH-1004 ID	LXL04_002810
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002810

Location Chr01:58739379-58742167 (+)

Description Similar to Omega-6 fatty acid desaturase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30950`	Chloroplast omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes.	Identification of a gene that complements an Arabidopsis mutant deficient in chloroplast omega 6 desaturase activity.1994 · DOI: 10.1104/pp.106.4.1453

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002810 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0010205 photoinhibition Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

GO:0102850 acyl-lipid (n+3)-(Z)-desaturase (ferredoxin) activity Molecular Function

KEGG gene cross-reference

ath:AT4G30950

gmx:547807

syp:SYNPCC7002_A2756

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · LXL04_002810 · OH-1004

Mitochondrion0.038

Rank 2 · LXL04_002810 · OH-1004

Endoplasmic reticulum0.029

Rank 3 · LXL04_002810 · OH-1004

Golgi apparatus0.019

Rank 4 · LXL04_002810 · OH-1004

Nucleus0.014

Rank 5 · LXL04_002810 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00487.31FA_desaturase158-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002810	`PF00487.31`	FA_desaturase	158	405	6.5e-31	108.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46312`	Arabidopsis thaliana	Omega-6 fatty acid desaturase, chloroplastic	70.678%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card