LXL04_002584 | RubberDandelionOmics

Gene overview

LXL04_002584

Reference: OH-1004 Chr: Chr01 Coordinates: 52415765-52418149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1239 bp · LXL04_002584|LXL04_002584|OH1004|cDNA

ATGCGAATGCTCTTCGGGTCATCAGTGGTTACAGTCTTCCCCAAGTTCACTCACAGTTTCTCTCCCTACTTATCAAATCGATCTGTCTCTGTAACAGCTTACGCGACCATGGCCACCGCCGCCGACTTTGTCAAAGGAAACGTCTTACCAAACGGTGTTGCTGTTATCACCCTCGATCGTCCAAAAGCTCTCAACGCCATGAATCTAGATATGGATCTAAGGTACAAAAGTTTCCTTGATGAATGGGAAACAGACCCAAA...

CDS

Download CDS FASTA

1239 bp · LXL04_002584|LXL04_002584|OH1004|CDS

ATGCGAATGCTCTTCGGGTCATCAGTGGTTACAGTCTTCCCCAAGTTCACTCACAGTTTCTCTCCCTACTTATCAAATCGATCTGTCTCTGTAACAGCTTACGCGACCATGGCCACCGCCGCCGACTTTGTCAAAGGAAACGTCTTACCAAACGGTGTTGCTGTTATCACCCTCGATCGTCCAAAAGCTCTCAACGCCATGAATCTAGATATGGATCTAAGGTACAAAAGTTTCCTTGATGAATGGGAAACAGACCCAAA...

Protein

Download Protein FASTA

412 aa · LXL04_002584|LXL04_002584|OH1004|PROTEIN

MRMLFGSSVVTVFPKFTHSFSPYLSNRSVSVTAYATMATAADFVKGNVLPNGVAVITLDRPKALNAMNLDMDLRYKSFLDEWETDPKVKCVLVEGSSSRAFSAGMDIKGVVAEIQKDKNTPLVQKVFGAEYSLICKIFNYKKPYISFMDGVTMGFGIGLSGHGRYRIITEKTLLAMPENGIGLFPDVGFAYIAAQSPGEGSVGAYLGITGNRISTPADALYVGLGTHFVPSGNLGPLKETLLSTTFSEDPHHDLEAILGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002584`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002584

Location Chr01:52415765-52418149 (+)

Description Similar to At4g13360: 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13360`	3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial.	No verified direct reference in this release
`At3g24360`	3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002584 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G24360

ath:AT4G13360

gga:423979

mmu:227095

rno:301384

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.697

Rank 1 · LXL04_002584 · OH-1004

Cytoplasm0.188

Rank 2 · LXL04_002584 · OH-1004

Plastid0.098

Rank 3 · LXL04_002584 · OH-1004

Peroxisome0.090

Rank 4 · LXL04_002584 · OH-1004

Nucleus0.068

Rank 5 · LXL04_002584 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378.26ECH_151-234 aa

PF16113.11ECH_254-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002584	`PF00378.26`	ECH_1	51	234	1.6e-23	84.1
LXL04_002584	`PF16113.11`	ECH_2	54	403	2.7e-104	350.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0K7`	Arabidopsis thaliana	3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial	71.287%	Swiss-Prot	strong database homology
`Q9LK08`	Arabidopsis thaliana	3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial	67.488%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card