LXL04_002555 | RubberDandelionOmics

Gene overview

LXL04_002555

Reference: OH-1004 Chr: Chr01 Coordinates: 51470469-51473409 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · LXL04_002555|LXL04_002555|OH1004|cDNA

ATGGGTGATCAAATATCACCCGTCATCAGAGACAGAGATCGGGAGCTGCTTCTCCCCATCGCCAACACCCCTGATGACCAACAAGCATCTCCAAAACCCCTGTCCGCTGCAACTTCCTTCTCCCATCAAACCGGCCGTGAGACTTTCTCCAAAGTTATTAGGAGCTGGGCGTCTAAAAAGTTCATGACGGGATGTGTGATCCTATTACCATTGGCTATTACTTTCTACATAACATGGTGGTTCATACATTTTGTGGATGG...

CDS

Download CDS FASTA

792 bp · LXL04_002555|LXL04_002555|OH1004|CDS

ATGGGTGATCAAATATCACCCGTCATCAGAGACAGAGATCGGGAGCTGCTTCTCCCCATCGCCAACACCCCTGATGACCAACAAGCATCTCCAAAACCCCTGTCCGCTGCAACTTCCTTCTCCCATCAAACCGGCCGTGAGACTTTCTCCAAAGTTATTAGGAGCTGGGCGTCTAAAAAGTTCATGACGGGATGTGTGATCCTATTACCATTGGCTATTACTTTCTACATAACATGGTGGTTCATACATTTTGTGGATGG...

Protein

Download Protein FASTA

263 aa · LXL04_002555|LXL04_002555|OH1004|PROTEIN

MGDQISPVIRDRDRELLLPIANTPDDQQASPKPLSAATSFSHQTGRETFSKVIRSWASKKFMTGCVILLPLAITFYITWWFIHFVDGFFSPILAQLGISIFGLGFITSVSFIFVVGIFMSSWLGASVLSLGEWFIKRMPFVRHIYDASKQISAAISPDQNSRAFKEVVIMRHPRVGEYAFGFITSSFTLRSYSEEEELYSVYVPTNHLYIGDIFLVNSKDVIRPNLSVREGIEIVVSGGMSMPQILTTFDLGIKEYGPRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002555`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002555

Location Chr01:51470469-51473409 (+)

Description Similar to COV1: Protein CONTINUOUS VASCULAR RING 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20120`	Involved in the regulation of vascular patterning in the stem, probably by negatively regulating the differentiation of vascular tissue.	Isolation of COV1, a gene involved in the regulation of vascular patterning in the stem of Arabidopsis.2003 · DOI: 10.1242/dev.00441
`At2g20130`	Protein LIKE COV 1.	No verified direct reference in this release
`At2g18460`	Protein LIKE COV 3.	No verified direct reference in this release
`At1g43130`	Protein LIKE COV 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002555 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G43130

ath:AT2G18460

ath:AT2G20120

ath:AT2G20130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.490

Rank 1 · LXL04_002555 · OH-1004

Golgi apparatus0.186

Rank 2 · LXL04_002555 · OH-1004

Nucleus0.103

Rank 3 · LXL04_002555 · OH-1004

Cytoplasm0.099

Rank 4 · LXL04_002555 · OH-1004

Cell membrane0.093

Rank 5 · LXL04_002555 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04367.19DUF502107-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002555	`PF04367.19`	DUF502	107	207	4e-26	91.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IUE7`	Arabidopsis thaliana	Protein CONTINUOUS VASCULAR RING 1	73.930%	Swiss-Prot	strong database homology
`Q8VY49`	Arabidopsis thaliana	Protein LIKE COV 1	74.800%	Swiss-Prot	strong database homology
`F4IQJ6`	Arabidopsis thaliana	Protein LIKE COV 3	66.160%	Swiss-Prot	strong database homology
`Q9C8C1`	Arabidopsis thaliana	Protein LIKE COV 2	67.841%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card