LXL04_002404 | RubberDandelionOmics

Gene overview

LXL04_002404

Reference: OH-1004 Chr: Chr01 Coordinates: 47982716-47985957 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1661 bp · LXL04_002404|LXL04_002404|OH1004|cDNA

AAGATTCAAGATTGAAAAATCTTGCATTTTAACCCAGAAATCTACAAACATTAAAGGAAAGTCTTTGGATAAAGCTCGTGTTGATTGAAGAAAACGTGAATTTTGTTATGGGTTTGTCCTTGTCCCTGTTATCATCAGCTTGGGAAGAAATCTTGGATCATAGTTACCTAATCTTGCCTTATGAACTTAATATTGGATCAAAAACCGATTGCTTCATTAAGTCTGAATCCGATACAATATCAAAAGAACCCGAAGAGTCG...

CDS

Download CDS FASTA

1581 bp · LXL04_002404|LXL04_002404|OH1004|CDS

TTGATTGAAGAAAACGTGAATTTTGTTATGGGTTTGTCCTTGTCCCTGTTATCATCAGCTTGGGAAGAAATCTTGGATCATAGTTACCTAATCTTGCCTTATGAACTTAATATTGGATCAAAAACCGATTGCTTCATTAAGTCTGAATCCGATACAATATCAAAAGAACCCGAAGAGTCGAATGTTGATCCAAGTAGAAAAAAATCGATCAATATGAAGAACCGTGAACCGTTAAAGATAATGCTAGAAACCACACTTTC...

Protein

Download Protein FASTA

526 aa · LXL04_002404|LXL04_002404|OH1004|PROTEIN

MIEENVNFVMGLSLSLLSSAWEEILDHSYLILPYELNIGSKTDCFIKSESDTISKEPEESNVDPSRKKSINMKNREPLKIMLETTLSFKNLVQDFKKPESRNTNLKRGRVGSPGATIFFSPRPVSELNAAATTVQKIYKSYRTRRNLADCAVVVEELWWKALDFAELDRSSVSFFNDDKPETASSRWARAGARAAKVGKGLSKNEKAQKLALQHWLEAIDPRHRYGHNLRIYYDLWFKSESSQPFFYWLDVGDGKEINVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002404`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002404

Location Chr01:47982716-47985957 (-)

Description Similar to IQM5: IQ domain-containing protein IQM5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57010`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At4g33050`	Involved in the modulation of stomatal movement.	AtIQM1, a novel calmodulin-binding protein, is involved in stomatal movement in Arabidopsis.2012 · DOI: 10.1007/s11103-012-9915-0
`At2g26190`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At3g13600`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At3g58480`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26190

ath:AT3G13600

ath:AT4G33050

ath:AT5G57010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · LXL04_002404 · OH-1004

Nucleus0.346

Rank 2 · LXL04_002404 · OH-1004

Cell membrane0.236

Rank 3 · LXL04_002404 · OH-1004

Plastid0.095

Rank 4 · LXL04_002404 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_002404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30383.1IQM_M279-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002404	`PF30383.1`	IQM_M	279	370	2.4e-45	153.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q058N0`	Arabidopsis thaliana	IQ domain-containing protein IQM5	58.017%	Swiss-Prot	strong database homology
`O82645`	Arabidopsis thaliana	IQ domain-containing protein IQM1	64.904%	Swiss-Prot	strong database homology
`O64851`	Arabidopsis thaliana	IQ domain-containing protein IQM4	63.592%	Swiss-Prot	strong database homology
`Q9LHN9`	Arabidopsis thaliana	IQ domain-containing protein IQM2	62.037%	Swiss-Prot	moderate database homology
`Q9M2G8`	Arabidopsis thaliana	IQ domain-containing protein IQM6	63.666%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card